Target General Infomation
Target ID
T23276
Former ID
TTDR00373
Target Name
Mitogen-activated protein kinase 3
Gene Name
MAPK3
Synonyms
ERK-1; ERT2; Extracellular signal-regulated kinase 1; Insulin-stimulated MAP2 kinase; MAP kinase 1; MAPK 1; Microtubule-associated protein-2 kinase; P44 Mitogen-activated protein kinase; P44-ERK1; P44-MAPK; MAPK3
Target Type
Clinical Trial
Disease Cancer [ICD9: 140-229; ICD10: C00-C96]
Restenosis [ICD10: I51.89]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Function
Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, FRS2 or GRB10). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade.
BioChemical Class
Kinase
UniProt ID
EC Number
EC 2.7.11.24
Sequence
MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
KELIFQETARFQPGVLEAP
Drugs and Mode of Action
Drug(s) BVD-523 Drug Info Phase 1/2 Cancer [524205]
GDC-0994 Drug Info Phase 1 Solid tumours [524324]
VAN-10-4-eluting stent Drug Info Phase 1 Restenosis [551983]
Inhibitor 6-[(E)-2-(4-Fluoro-phenyl)-vinyl]-9H-purine Drug Info [527421]
VAN-10-4-eluting stent Drug Info [550172]
Modulator BVD-523 Drug Info
GDC-0994 Drug Info
Pathways
KEGG Pathway MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Oocyte meiosis
mTOR signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Dorso-ventral axis formation
TGF-beta signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Adherens junction
Gap junction
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Circadian entrainment
Long-term potentiation
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Type II diabetes mellitus
Aldosterone-regulated sodium reabsorption
Alzheimer&#039
s disease
Prion diseases
Alcoholism
Shigellosis
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Influenza A
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
NetPath Pathway IL5 Signaling Pathway
TCR Signaling Pathway
PANTHER Pathway Alzheimer disease-amyloid secretase pathway
Angiogenesis
Apoptosis signaling pathway
B cell activation
EGF receptor signaling pathway
Endothelin signaling pathway
FGF signaling pathway
Inflammation mediated by chemokine and cytokine signaling pathway
Insulin/IGF pathway-mitogen activated protein kinase kinase/MAP kinase cascade
Integrin signalling pathway
Interferon-gamma signaling pathway
Interleukin signaling pathway
PDGF signaling pathway
Parkinson disease
TGF-beta signaling pathway
T cell activation
Toll receptor signaling pathway
VEGF signaling pathway
Ras Pathway
Angiotensin II-stimulated signaling through G proteins and beta-arrestin
CCKR signaling map ST
Pathway Interaction Database Fc-epsilon receptor I signaling in mast cells
Endothelins
BCR signaling pathway
Signaling events mediated by PRL
ErbB4 signaling events
GMCSF-mediated signaling events
Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met)
S1P3 pathway
EPHB forward signaling
Osteopontin-mediated events
S1P4 pathway
Presenilin action in Notch and Wnt signaling
TRAIL signaling pathway
CDC42 signaling events
Signaling events regulated by Ret tyrosine kinase
Angiopoietin receptor Tie2-mediated signaling
S1P1 pathway
Regulation of Telomerase
Netrin-mediated signaling events
Role of Calcineurin-dependent NFAT signaling in lymphocytes
Glucocorticoid receptor regulatory network
Arf6 downstream pathway
mTOR signaling pathway
IL2-mediated signaling events
EGF receptor (ErbB1) signaling pathway
Ras signaling in the CD4+ TCR pathway
Ceramide signaling pathway
Integrins in angiogenesis
IFN-gamma pathway
ErbB1 downstream signaling
ATF-2 transcription factor network
ErbB2/ErbB3 signaling events
ALK1 signaling events
PDGFR-beta signaling pathway
Neurotrophic factor-mediated Trk receptor signaling
Syndecan-1-mediated signaling events
Retinoic acid receptors-mediated signaling
Nongenotropic Androgen signaling
CXCR3-mediated signaling events
VEGFR1 specific signals
Regulation of cytoplasmic and nuclear SMAD2/3 signaling
Signaling events mediated by Stem cell factor receptor (c-Kit)
Signaling events mediated by VEGFR1 and VEGFR2
Syndecan-2-mediated signaling events
Cellular roles of Anthrax toxin
S1P2 pathway
Trk receptor signaling mediated by the MAPK pathway
Downstream signaling in na&amp
#xef
ve CD8+ T cells
VEGFR3 signaling in lymphatic endothelium
Alpha-synuclein signaling
FGF signaling pathway
Reactome MAPK3 (ERK1) activation
RAF-independent MAPK1/3 activation
ISG15 antiviral mechanism
ERK/MAPK targets
Regulation of actin dynamics for phagocytic cup formation
Oxidative Stress Induced Senescence
Senescence-Associated Secretory Phenotype (SASP)
Oncogene Induced Senescence
FCERI mediated MAPK activation
Regulation of HSF1-mediated heat shock response
NCAM signaling for neurite out-growth
Activation of the AP-1 family of transcription factors
Thrombin signalling through proteinase activated receptors (PARs)
Negative regulation of FGFR1 signaling
Negative regulation of FGFR2 signaling
Negative regulation of FGFR3 signaling
Negative regulation of FGFR4 signaling
RHO GTPases Activate WASPs and WAVEs
RAF/MAP kinase cascade
MAP2K and MAPK activation
Negative feedback regulation of MAPK pathway
Negative regulation of MAPK pathway
Signal attenuation
Advanced glycosylation endproduct receptor signaling
Gastrin-CREB signalling pathway via PKC and MAPK
Growth hormone receptor signaling
WikiPathways Toll-like receptor signaling pathway
Serotonin Receptor 4/6/7 and NR3C Signaling
Serotonin Receptor 2 and ELK-SRF/GATA4 signaling
Serotonin HTR1 Group and FOS Pathway
TCR Signaling Pathway
Hypothetical Network for Drug Addiction
EPO Receptor Signaling
TGF Beta Signaling Pathway
Regulation of Actin Cytoskeleton
IL-2 Signaling Pathway
Insulin Signaling
MAPK Cascade
IL-4 Signaling Pathway
MAPK Signaling Pathway
IL-6 signaling pathway
Signaling of Hepatocyte Growth Factor Receptor
Kit receptor signaling pathway
TCA Cycle Nutrient Utilization and Invasiveness of Ovarian Cancer
IL-3 Signaling Pathway
Cardiac Hypertrophic Response
MAP kinase activation in TLR cascade
Fc epsilon receptor (FCERI) signaling
RAF/MAP kinase cascade
Structural Pathway of Interleukin 1 (IL-1)
Genes and (Common) Pathways Underlying Drug Addiction
Signal Transduction of S1P Receptor
PDGF Pathway
Alpha 6 Beta 4 signaling pathway
Spinal Cord Injury
BDNF signaling pathway
Integrated Pancreatic Cancer Pathway
Oncostatin M Signaling Pathway
Corticotropin-releasing hormone
Interleukin-11 Signaling Pathway
AGE/RAGE pathway
TNF alpha Signaling Pathway
Prostate Cancer
Signaling Pathways in Glioblastoma
TSLP Signaling Pathway
IL-9 Signaling Pathway
IL17 signaling pathway
Alzheimers Disease
IL-7 Signaling Pathway
TWEAK Signaling Pathway
FSH signaling pathway
Leptin signaling pathway
RANKL/RANK Signaling Pathway
IL-1 signaling pathway
Thrombin signalling through proteinase activated receptors (PARs)
Signaling by Insulin receptor
Signaling by FGFR
RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription
L1CAM interactions
Advanced glycosylation endproduct receptor signaling
Apoptosis Modulation and Signaling
MicroRNAs in cardiomyocyte hypertrophy
Regulation of toll-like receptor signaling pathway
Osteopontin Signaling
IL-5 Signaling Pathway
References
Ref 524205ClinicalTrials.gov (NCT01781429) Phase I Dose-Escalation, Safety, Pharmacokinetic and Pharmacodynamic Study of BVD-523 in Patients With Advanced Malignancies. U.S. National Institutes of Health.
Ref 524324ClinicalTrials.gov (NCT01875705) A Dose-Escalation Study of GDC-0994 in Patients With Locally Advanced or Metastatic Solid Tumors. U.S. National Institutes of Health.
Ref 551983Drug-Eluting Stent for High Risk Patients. University of Strathclyde Glasgow. 2015
Ref 527421J Med Chem. 2005 Feb 10;48(3):710-22.Synthesis and biological testing of purine derivatives as potential ATP-competitive kinase inhibitors.
Ref 550172WO patent application no. 2013,1850,32, Nanotherapeutics for drug targeting.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.