Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T16308
|
||||
Former ID |
TTDR00355
|
||||
Target Name |
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
|
||||
Gene Name |
PIN1
|
||||
Synonyms |
PPIase Pin1; Peptidyl prolyl cis/trans isomerase Pin1; Prolyl isomerase Pin1; Rotamase Pin1; PIN1
|
||||
Target Type |
Research
|
||||
Function |
Essential PPIase that regulates mitosis presumably by interacting with NIMA and attenuating its mitosis-promoting activity. Displays a preference for an acidic residue N-terminal to the isomerized proline bond. Catalyzes pSer/Thr-Pro cis/trans isomerizations. Down-regulates kinase activity of BTK. Can transactivate multiple oncogenes and induce centrosome amplification, chromosome instability and cell transformation. Required for the efficient dephosphorylation and recycling of RAF1 after mitogen activation. Binds and targets PML and BCL6 for degradation in a phosphorylation-dependent manner.
|
||||
BioChemical Class |
Cis-trans-isomerases
|
||||
Target Validation |
T16308
|
||||
UniProt ID | |||||
EC Number |
EC 5.2.1.8
|
||||
Sequence |
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE |
||||
Inhibitor | (R)-2-(2-naphthamido)-3-m-tolylpropanoic acid | Drug Info | [530771] | ||
(R)-2-(2-naphthamido)-3-p-tolylpropanoic acid | Drug Info | [530771] | |||
(R)-2-(2-naphthamido)-5-phenylpent-4-ynoic acid | Drug Info | [530771] | |||
(R)-3-(2-naphthamido)-4-m-tolylbutanoic acid | Drug Info | [530771] | |||
(R,)-2-(2-naphthamido)-5-phenylpent-4-enoic acid | Drug Info | [530771] | |||
3,6,9,12,15,18-HEXAOXAICOSANE | Drug Info | [551374] | |||
Ac-Bth-Thr(PO3H2)-Pip-Nal-Gln-NH2 | Drug Info | [528104] | |||
Ac-Phe-D-Thr(PO3H2)-Pip-Nal-Gln-NH2 | Drug Info | [528104] | |||
Ac-Phe-Thr(PO3H2)-Pip-Nal-Gln-NH2 | Drug Info | [528104] | |||
Beta-(2-Naphthyl)-Alanine | Drug Info | [551374] | |||
Pathways | |||||
KEGG Pathway | RIG-I-like receptor signaling pathway | ||||
Pathway Interaction Database | p73 transcription factor network | ||||
C-MYC pathway | |||||
PDGFR-beta signaling pathway | |||||
p53 pathway | |||||
Reactome | ISG15 antiviral mechanism | ||||
Negative regulators of RIG-I/MDA5 signaling | |||||
WikiPathways | ISG15 antiviral mechanism | ||||
RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.