Resistance mutation info of target
Target General Information | |||||
---|---|---|---|---|---|
Target ID | T63505 | ||||
Target Name | Tyrosine-protein kinase ABL1(ABL1) | Target Info | |||
Gene Name | ABL1 | ||||
Species | Homo sapiens | ||||
Uniprot ID | ABL1_HUMAN | ||||
Sequence | MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSE NDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN SLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTAS DGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERT DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFI HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP SDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAE HRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLF SALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSP KPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSAS CVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTV TPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGS ALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP PPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVL PATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPE RIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNK FAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR [Homo sap iens] |
||||
Drug Resistance Mutation and Corresponding Drugs | |||||
Mutation Info | Missense: A344V | ||||
Mutation Info | Missense: A350V | ||||
Mutation Info | Missense: A365V | ||||
Mutation Info | Missense: A366G | ||||
Mutation Info | Missense: A380T | ||||
Mutation Info | Missense: A397P | ||||
Mutation Info | Missense: A399T | ||||
Mutation Info | Missense: A433T | ||||
Mutation Info | Missense: D276A | ||||
Mutation Info | Missense: D276G | ||||
Mutation Info | Missense: D276N | ||||
Mutation Info | Missense: D363Y | ||||
Mutation Info | Missense: D444Y | ||||
Mutation Info | Missense: D482V | ||||
Mutation Info | Missense: E255K | ||||
Mutation Info | Missense: E255V | ||||
Mutation Info | Missense: E258D | ||||
Mutation Info | Missense: E275K | ||||
Mutation Info | Missense: E275Q | ||||
Mutation Info | Missense: E279A | ||||
Mutation Info | Missense: E279K | ||||
Mutation Info | Missense: E279Y | ||||
Mutation Info | Missense: E279Z | ||||
Mutation Info | Missense: E282G | ||||
Mutation Info | Missense: E282K | ||||
Mutation Info | Missense: E292Q | ||||
Mutation Info | Missense: E292V | ||||
Mutation Info | Missense: E352D | ||||
Mutation Info | Missense: E352G | ||||
Mutation Info | Missense: E355? | ||||
Mutation Info | Missense: E355A | ||||
Mutation Info | Missense: E355D | ||||
Mutation Info | Missense: E355G | ||||
Mutation Info | Missense: E373K | ||||
Mutation Info | Missense: E450? | ||||
Mutation Info | Missense: E450A | ||||
Mutation Info | Missense: E450G | ||||
Mutation Info | Missense: E450K | ||||
Mutation Info | Missense: E450V | ||||
Mutation Info | Missense: E453A | ||||
Mutation Info | Missense: E453D | ||||
Mutation Info | Missense: E453G | ||||
Mutation Info | Missense: E453K | ||||
Mutation Info | Missense: E453L | ||||
Mutation Info | Missense: E453V | ||||
Mutation Info | Missense: E459A | ||||
Mutation Info | Missense: E459G | ||||
Mutation Info | Missense: E459K | ||||
Mutation Info | Missense: E459Q | ||||
Mutation Info | Missense: E459V | ||||
Mutation Info | Missense: E494G | ||||
Mutation Info | Missense: E507G | ||||
Mutation Info | Missense: F311I | ||||
Mutation Info | Missense: F311L | ||||
Mutation Info | Missense: F317C | ||||
Mutation Info | Missense: F317I | ||||
Mutation Info | Missense: F317L | ||||
Mutation Info | Missense: F317R | ||||
Mutation Info | Missense: F317V | ||||
Mutation Info | Missense: F359* | ||||
Mutation Info | Missense: F359? | ||||
Mutation Info | Missense: F359A | ||||
Mutation Info | Missense: F359C | ||||
Mutation Info | Missense: F359I | ||||
Mutation Info | Missense: F359L | ||||
Mutation Info | Missense: F359V | ||||
Mutation Info | Missense: F382L | ||||
Mutation Info | Missense: F486S | ||||
Mutation Info | Missense: G250E | ||||
Mutation Info | Missense: G250R | ||||
Mutation Info | Missense: G251D | ||||
Mutation Info | Missense: G251E | ||||
Mutation Info | Missense: G398R | ||||
Mutation Info | Missense: H396A | ||||
Mutation Info | Missense: H396P | ||||
Mutation Info | Missense: H396R | ||||
Mutation Info | Missense: I242T | ||||
Mutation Info | Missense: I293V | ||||
Mutation Info | Missense: I418S | ||||
Mutation Info | Missense: I418V | ||||
Mutation Info | Missense: K247R | ||||
Mutation Info | Missense: K294 > RGG | ||||
Mutation Info | Missense: K378R | ||||
Mutation Info | Missense: K419E | ||||
Mutation Info | Missense: L248R | ||||
Mutation Info | Missense: L248V | ||||
Mutation Info | Missense: L273M | ||||
Mutation Info | Missense: L298V | ||||
Mutation Info | Missense: L324Q | ||||
Mutation Info | Missense: L340L | ||||
Mutation Info | Missense: L364I | ||||
Mutation Info | Missense: L370P | ||||
Mutation Info | Missense: L384M | ||||
Mutation Info | Missense: L387F | ||||
Mutation Info | Missense: L387M | ||||
Mutation Info | Missense: L387V | ||||
Mutation Info | Missense: M237V | ||||
Mutation Info | Missense: M244V | ||||
Mutation Info | Missense: M343T | ||||
Mutation Info | Missense: M351K | ||||
Mutation Info | Missense: M351T | ||||
Mutation Info | Missense: M388L | ||||
Mutation Info | Missense: M472I | ||||
Mutation Info | Missense: N368S | ||||
Mutation Info | Missense: N374Y | ||||
Mutation Info | Missense: P480L | ||||
Mutation Info | Missense: Q252E | ||||
Mutation Info | Missense: Q252H | ||||
Mutation Info | Missense: Q252K | ||||
Mutation Info | Missense: Q252R | ||||
Mutation Info | Missense: R220H | ||||
Mutation Info | Missense: R328M | ||||
Mutation Info | Missense: S417F | ||||
Mutation Info | Missense: S417Y | ||||
Mutation Info | Missense: S438C | ||||
Mutation Info | Missense: T277A | ||||
Mutation Info | Missense: T315A | ||||
Mutation Info | Missense: T315I | ||||
Mutation Info | Missense: T315N | ||||
Mutation Info | Missense: T315V | ||||
Mutation Info | Missense: T495R | ||||
Mutation Info | Missense: V256L | ||||
Mutation Info | Missense: V280A | ||||
Mutation Info | Missense: V289A | ||||
Mutation Info | Missense: V289F | ||||
Mutation Info | Missense: V289I | ||||
Mutation Info | Missense: V299L | ||||
Mutation Info | Missense: V371A | ||||
Mutation Info | Missense: V379I | ||||
Mutation Info | Missense: W261L | ||||
Mutation Info | Missense: Y253F | ||||
Mutation Info | Missense: Y253H | ||||
Mutation Info | Missense: Y320C | ||||
Mutation Info | Missense: Y342H | ||||
Mutation Info | Missense: Y353H | ||||
Mutation Info | Missense: Y393C | ||||
Reference | |||||
Ref 555502 | Multiple BCR-ABL kinase domain mutations confer polyclonal resistance to the tyrosine kinase inhibitor imatinib (STI571) in chronic phase and blast crisis chronic myeloid leukemia. Cancer Cell. 2002 Aug;2(2):117-25. | ||||
Ref 555505 | Molecular and chromosomal mechanisms of resistance to imatinib (STI571) therapy. Leukemia. 2002 Nov;16(11):2190-6. | ||||
Ref 555513 | Detection of BCR-ABL mutations in patients with CML treated with imatinib is virtually always accompanied by clinical resistance, and mutations in the ATP phosphate-binding loop (P-loop) are associated with a poor prognosis. Blood. 2003 Jul 1;102(1):276-83. Epub 2003 Mar 6. | ||||
Ref 555534 | High incidence of BCR-ABL kinase domain mutations and absence of mutations of the PDGFR and KIT activation loops in CML patients with secondary resistance to imatinib. Hematol J. 2004;5(1):55-60. | ||||
Ref 555547 | Evidence of ABL-kinase domain mutations in highly purified primitive stem cell populations of patients with chronic myelogenous leukemia. Biochem Biophys Res Commun. 2004 Oct 22;323(3):728-30. | ||||
Ref 555696 | Sequential development of mutant clones in an imatinib resistant chronic myeloid leukaemia patient following sequential treatment with multiple tyrosine kinase inhibitors: an emerging problem? Cancer Chemother Pharmacol. 2009 Jun;64(1):195-7. doi: 10.1007/s00280-008-0905-5. Epub 2009 Jan 21. | ||||
Ref 555699 | Complexity of BCR-ABL kinase domain mutations during the course of therapy with tyrosine kinase inhibitors in chronic myeloid leukemia. Am J Hematol. 2009 Apr;84(4):256-7. doi: 10.1002/ajh.21366. | ||||
Ref 555715 | Long-term outcome of patients with chronic myeloid leukemia treated with second-generation tyrosine kinase inhibitors after imatinib failure is predicted by the in vitro sensitivity of BCR-ABL kinase domain mutations. Blood. 2009 Sep 3;114(10):2037-43. doi: 10.1182/blood-2009-01-197715. Epub 2009 Jun 30. | ||||
Ref 555719 | Determining the rise in BCR-ABL RNA that optimally predicts a kinase domain mutation in patients with chronic myeloid leukemia on imatinib. Blood. 2009 Sep 24;114(13):2598-605. doi: 10.1182/blood-2008-08-173674. Epub 2009 Jul 22. | ||||
Ref 555730 | Dynamic change of T315I BCR-ABL kinase domain mutation in Korean chronic myeloid leukaemia patients during treatment with Abl tyrosine kinase inhibitors. Hematol Oncol. 2010 Jun;28(2):82-8. doi: 10.1002/hon.918. | ||||
Ref 555735 | Spectrum of BCR-ABL kinase domain mutations in patients with chronic myeloid leukemia from India with suspected resistance to imatinib-mutations are rare and have different distributions. Leuk Lymphoma. 2009 Dec;50(12):2092-5. doi: 10.3109/10428190903332486. | ||||
Ref 555745 | Kinase domain mutations and responses to dose escalation in chronic myeloid leukemia resistant to standard dose imatinib mesylate. Leuk Lymphoma. 2010 Jan;51(1):79-84. doi: 10.3109/10428190903437629. | ||||
Ref 555754 | Mutations in ABL kinase domain are associated with inferior progression-free survival. Leuk Lymphoma. 2010 Jun;51(6):1072-8. doi: 10.3109/10428191003729741. | ||||
Ref 555758 | Rapid and sensitive allele-specific (AS)-RT-PCR assay for detection of T315I mutation in chronic myeloid leukemia patients treated with tyrosine-kinase inhibitors. Clin Exp Med. 2011 Mar;11(1):55-9. doi: 10.1007/s10238-010-0101-x. Epub 2010 May 29. | ||||
Ref 555765 | Longitudinal studies of SRC family kinases in imatinib- and dasatinib-resistant chronic myelogenous leukemia patients. Leuk Res. 2011 Jan;35(1):38-43. doi: 10.1016/j.leukres.2010.06.030. Epub 2010 Jul 29. | ||||
Ref 555769 | Characteristics of BCR-ABL kinase domain point mutations in Chinese imatinib-resistant chronic myeloid leukemia patients. Ann Hematol. 2011 Jan;90(1):47-52. doi: 10.1007/s00277-010-1039-5. Epub 2010 Aug 10. | ||||
Ref 555785 | Results of allogeneic hematopoietic stem cell transplantation for chronic myelogenous leukemia patients who failed tyrosine kinase inhibitors after developing BCR-ABL1 kinase domain mutations. Blood. 2011 Mar 31;117(13):3641-7. doi: 10.1182/blood-2010-08-302679. Epub 2010 Dec 14. | ||||
Ref 555788 | BCR-ABL isoforms associated with intrinsic or acquired resistance to imatinib: more heterogeneous than just ABL kinase domain point mutations? Med Oncol. 2012 Mar;29(1):219-26. doi: 10.1007/s12032-010-9781-z. Epub 2011 Jan 8. | ||||
Ref 555789 | BCR-ABL1 mutations in patients with imatinib-resistant Philadelphia chromosome-positive leukemia by use of the PCR-Invader assay. Leuk Res. 2011 May;35(5):598-603. doi: 10.1016/j.leukres.2010.12.006. Epub 2011 Jan 15. | ||||
Ref 555791 | A novel insertion mutation of K294RGG within BCR-ABL kinase domain confers imatinib resistance: sequential analysis of the clonal evolution in a patient with chronic myeloid leukemia in blast crisis. Int J Hematol. 2011 Feb;93(2):237-42. doi: 10.1007/s12185-011-0766-2. Epub 2011 Jan 25. | ||||
Ref 555796 | Outcome of patients with chronic myeloid leukemia with multiple ABL1 kinase domain mutations receiving tyrosine kinase inhibitor therapy. Haematologica. 2011 Jun;96(6):918-21. doi: 10.3324/haematol.2010.039321. Epub 2011 Feb 28. | ||||
Ref 555806 | BCR-ABL kinase domain mutation analysis in chronic myeloid leukemia patients treated with tyrosine kinase inhibitors: recommendations from an expert panel on behalf of European LeukemiaNet. Blood. 2011 Aug 4;118(5):1208-15. doi: 10.1182/blood-2010-12-326405. Epub 2011 May 11. | ||||
Ref 555810 | Clinical outcome of chronic myeloid leukemia imatinib-resistant patients: do BCR-ABL kinase domain mutations affect patient survival? First multicenter Argentinean study. Leuk Lymphoma. 2011 Sep;52(9):1720-6. doi: 10.3109/10428194.2011.578310. Epub 2011 Jun 12. | ||||
Ref 555813 | Use of direct sequencing for detection of mutations in the BCR-ABL kinase domain in Slovak patients with chronic myeloid leukemia. Neoplasma. 2011;58(6):548-53. | ||||
Ref 555817 | Dasatinib as first-line treatment for adult patients with Philadelphia chromosome-positive acute lymphoblastic leukemia. Blood. 2011 Dec 15;118(25):6521-8. doi: 10.1182/blood-2011-05-351403. Epub 2011 Sep 19. | ||||
Ref 555819 | ABL domain kinase point mutations as a cause of resistance to therapy of patients with chronic myeloid leukemia with tyrosine kinase inhibitors | ||||
Ref 555854 | Analysis of mutations in the BCR-ABL1 kinase domain, using direct sequencing: detection of the T315I mutation in bone marrow CD34+ cells of a patient with chronic myelogenous leukemia 6 months prior to its emergence in peripheral blood. Mol Diagn Ther. 2012 Jun 1;16(3):163-6. doi: 10.2165/11632420-000000000-00000. | ||||
Ref 555881 | Early detection and quantification of mutations in the tyrosine kinase domain of chimerical BCR-ABL1 gene combining high-resolution melting analysis and mutant-allele specific quantitative polymerase chain reaction. Leuk Lymphoma. 2013 Mar;54(3):598-606. doi: 10.3109/10428194.2012.718767. Epub 2012 Aug 31. | ||||
Ref 555882 | Role of treatment in the appearance and selection of BCR-ABL1 kinase domain mutations. Mol Diagn Ther. 2012 Aug 1;16(4):251-9. doi: 10.2165/11635340-000000000-00000. | ||||
Ref 555892 | Three novel patient-derived BCR/ABL mutants show different sensitivity to second and third generation tyrosine kinase inhibitors. Am J Hematol. 2012 Nov;87(11):E125-8. doi: 10.1002/ajh.23338. Epub 2012 Oct 9. | ||||
Ref 555893 | Impact of BCR-ABL mutations on response to dasatinib after imatinib failure in elderly patients with chronic-phase chronic myeloid leukemia. Ann Hematol. 2013 Jan;92(2):179-83. doi: 10.1007/s00277-012-1591-2. Epub 2012 Oct 10. | ||||
Ref 555898 | Characteristics and outcomes of patients with V299L BCR-ABL kinase domain mutation after therapy with tyrosine kinase inhibitors. Blood. 2012 Oct 18;120(16):3382-3. doi: 10.1182/blood-2012-04-424192. | ||||
Ref 555909 | BCR-ABL1 compound mutations in tyrosine kinase inhibitor-resistant CML: frequency and clonal relationships. Blood. 2013 Jan 17;121(3):489-98. doi: 10.1182/blood-2012-05-431379. Epub 2012 Dec 5. | ||||
Ref 555918 | Contribution of BCR-ABL kinase domain mutations to imatinib mesylate resistance in Philadelphia chromosome positive Malaysian chronic myeloid leukemia patients. Hematol Rep. 2012 Nov 19;4(4):e23. doi: 10.4081/hr.2012.e23. Epub 2012 Nov 23. | ||||
Ref 555923 | Frequency of ABL gene mutations in chronic myeloid leukemia patients resistant to imatinib and results of treatment switch to second-generation tyrosine kinase inhibitors. Med Clin (Barc). 2013 Aug 4;141(3):95-9. doi: 10.1016/j.medcli.2012.10.028. Epub 2013 Feb 22. | ||||
Ref 555945 | Detection of BCR-ABL kinase domain mutations in patients with chronic myeloid leukemia on imatinib. Hematology. 2013 Nov;18(6):328-33. doi: 10.1179/1607845413Y.0000000095. Epub 2013 May 8. | ||||
Ref 555955 | BCR-ABL1 kinase domain mutations may persist at very low levels for many years and lead to subsequent TKI resistance. Br J Cancer. 2013 Sep 17;109(6):1593-8. doi: 10.1038/bjc.2013.318. Epub 2013 Jun 25. | ||||
Ref 555981 | The genetic landscape of clinical resistance to RAF inhibition in metastatic melanoma. Cancer Discov. 2014 Jan;4(1):94-109. doi: 10.1158/2159-8290.CD-13-0617. Epub 2013 Nov 21. | ||||
Ref 555990 | BCR-ABL kinase domain mutations, including 2 novel mutations in imatinib resistant Malaysian chronic myeloid leukemia patients-Frequency and clinical outcome. Leuk Res. 2014 Apr;38(4):454-9. doi: 10.1016/j.leukres.2013.12.025. Epub 2014 Jan 6. | ||||
Ref 556031 | Increased genomic instability may contribute to the development of kinase domain mutations in chronic myeloid leukemia. Int J Hematol. 2014 Dec;100(6):567-74. doi: 10.1007/s12185-014-1685-9. Epub 2014 Oct 4. | ||||
Ref 556052 | Incidence and clinical importance of BCR-ABL1 mutations in Iranian patients with chronic myeloid leukemia on imatinib. J Hum Genet. 2015 May;60(5):253-8. doi: 10.1038/jhg.2015.11. Epub 2015 Mar 5. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.