Target Information

Target General Infomation
Target ID
T98708
Former ID
TTDI01944
Target Name
Parathyroid hormone ligand
Gene Name
PTH
Synonyms
Parathormone; Parathyrin; Parathyroid hormone; PTH
Target Type
Successful
Disease Bone disease [ICD10: M00-M99]
Osteogenesis imperfecta [ICD9: 756.51; ICD10: Q78.0]
Osteoporosis [ICD9: 733.0, V07.4; ICD10: M80-M81, Z79.890]
Parathyroid disease [ICD10: E20-E21]
Unspecified [ICD code not available]
Function
PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2- deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
BioChemical Class
Parathyroid hormone family
UniProt ID
P01270
Sequence
MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQ
DVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Drugs and Mode of Action
Drug(s) Teriparatide Drug Info Approved Osteogenesis imperfecta [467716], [536361]
KUR-111 Drug Info Phase 2 Bone disease [522008]
Ostabolin-C Drug Info Phase 2 Osteoporosis [549917]
ABX-PTH Drug Info Terminated Parathyroid disease [547899]
SUN-E3001 Drug Info Terminated Osteoporosis [547293]
Teriparatide Drug Info Investigative Unspecified [1572605]
Modulator KUR-111 Drug Info
MG-1101 Drug Info
Ostabolin-C Drug Info
parathyroid hormone (oral), Nobex Drug Info
SUN-E3001 Drug Info
Teriparatide Drug Info [556264]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
Reactome Class B/2 (Secretin family receptors)
G alpha (s) signalling events
WikiPathways Endochondral Ossification
Osteoblast Signaling
Vitamin D Receptor Pathway
GPCR ligand binding
GPCR downstream signaling
Vitamin D Metabolism
References
Ref 467716(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4448).
Ref 522008ClinicalTrials.gov (NCT00459641) Safety and Tolerability of I-040302 in Children and Young Adults With Solitary Bone Cysts. U.S. National Institutes of Health.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 547293Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014905)
Ref 547899Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020246)
Ref 549917Clinical pipeline report, company report or official report of nektar.
Ref 1572605The ChEMBL database in 2017.
Ref 551661Focus on parathyroid carcinoma. International Journal of Surgery Volume 9, Issue 1, 2011, Pages 13-19.
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.