Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T31230
|
||||
| Former ID |
TTDS00307
|
||||
| Target Name |
Fumarate reductase flavoprotein subunit
|
||||
| Gene Name |
frdA
|
||||
| Synonyms |
FRDA; Fumarate reductase; frdA
|
||||
| Target Type |
Successful
|
||||
| Disease | Dutch elm disease; Helminth infection [ICD9:001-139; ICD10: B81-B83, A00-B99] | ||||
| Mature gastrointestinal nematode infections [ICD9: 127; ICD10: B77-B81] | |||||
| Trichuris trichiura infection [ICD9: 127.3; ICD10: B79] | |||||
| Function |
Two distinct, membrane-bound, fad-containing enzymes are responsible for the catalysis of fumarate and succinate interconversion; The fumarate reductase is used in anaerobic growth, and the succinate dehydrogenase is used in aerobic growth.
|
||||
| BioChemical Class |
Oxidoreductases acting on CH-CH group of donors
|
||||
| UniProt ID | |||||
| EC Number |
EC 1.3.99.1
|
||||
| Sequence |
MKITYCDALIIGGGLAGLRASIACKQKGLNTIVLSLVPVRRSHSAAAQGGMQASLANAKK
SEGDNEDLHFLDTVKGSDWGCDQQVARMFVTTAPKAIRELASWGVPWTRIKKGDRPAVVN GEHVTITERDDRHGYILSRDFGGTKKWRTCFTADATGHTMLYAVANEALHHKVDIQDRKD MLAFIHHDNKCYGAVVRDLITGEISAYVSKGTLLATGGYGRVYKHTTNAVICDGAGAASA LETGVAKLGNMEAVQFHPTALVPSGILMTEGCRGDGGVLRDKFGRRFMPAYEPEKKELAS RDVVSRRILEHIQKGYGAKSPYGDHVWLDIAILGRNHVEKNLRDVRDIAMTFAGIDPADS KEQTKDNMQGVPANEPEYGQAMAKQKGWIPIKPMQHYSMGGVRTNPKGETHLKGLFCAGE AACWDLHGFNRLGGNSVSEAVVAGMIIGDYFASHCLEAQIEINTQKVEAFIKESQDYMHF LLHNEGKEDVYEIRERMKEVMDEKVGVFREGKRLEEALKELQELYARSKNICVKNKVLHN NPELEDAYRTKKMLKLALCITQGALLRTESRGAHTRIDYPKRDDEKWLNRTLASWPSAEQ DMPTIEYEELDVMKMEISPDFRGYGKKGNFIPHPKKEERDAEILKTILELEKLGKDRIEV QHALMPFELQEKYKARNMRLEDEEVRARGEHLYSFNVHELLDQHNANLKGEHHE |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Morantel tartrate | Drug Info | Approved | Mature gastrointestinal nematode infections | [1] |
| Oxantel pamoate | Drug Info | Approved | Trichuris trichiura infection | [2] | |
| Thiabendazole | Drug Info | Approved | Dutch elm disease; Helminth infection | [3], [4], [5] | |
| Inhibitor | 2,3-DIMETHYL-1,4-NAPHTHOQUINONE | Drug Info | [6] | ||
| 2-HEPTYL-4-HYDROXY QUINOLINE N-OXIDE | Drug Info | [6] | |||
| 2-[1-(4-CHLORO-PHENYL)-ETHYL]-4,6-DINITRO-PHENOL | Drug Info | [6] | |||
| Citraconic acid | Drug Info | [7] | |||
| Flavin-Adenine Dinucleotide | Drug Info | [8] | |||
| Fumarate | Drug Info | [8] | |||
| Heme | Drug Info | [6] | |||
| Malate Like Intermediate | Drug Info | [7] | |||
| Morantel tartrate | Drug Info | [2], [9] | |||
| Oxantel pamoate | Drug Info | [2] | |||
| Thiabendazole | Drug Info | [2] | |||
| References | |||||
| REF 1 | Morantel tartrate. Canadian Food Inspection Agency. Government of Canada. 2010-08. | ||||
| REF 2 | Fumarate reductase is essential for Helicobacter pylori colonization of the mouse stomach. Microb Pathog. 2000 Nov;29(5):279-87. | ||||
| REF 3 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016096. | ||||
| REF 4 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7304). | ||||
| REF 5 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
| REF 6 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | ||||
| REF 7 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January | ||||
| REF 8 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
| REF 9 | Fumarate reductase: a target for therapeutic intervention against Helicobacter pylori. Arch Biochem Biophys. 1995 Aug 1;321(1):153-9. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.