Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T22658
|
||||
| Former ID |
TTDR00205
|
||||
| Target Name |
Interleukin-8
|
||||
| Gene Name |
CXCL8
|
||||
| Synonyms |
Emoctakin; GCP-1; Granulocyte chemotacticprotein 1; IL-8; LYNAP; Lymphocyte-derived neutrophil-activating factor; MDNCF; MONAP; Monocyte derived neutrophil activating peptide; Monocyte-derived neutrophil chemotactic factor; NAF; NAP-1; Neutrophil-activating factor; Neutrophil-activating protein 1; Protein 3-10C; T-cell chemotactic factor; CXCL8
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
| Melanoma [ICD9: 172; ICD10: C43] | |||||
| Function |
Il-8 is a chemotactic factor that attracts neutrophils, basophils, and t-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
|
||||
| BioChemical Class |
Intercrine-alpha family
|
||||
| Target Validation |
T22658
|
||||
| UniProt ID | |||||
| Sequence |
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | ABX-IL8 | Drug Info | Phase 2 | Melanoma | [1] |
| MDX-018 | Drug Info | Phase 1 | Autoimmune diabetes | [2] | |
| R-KETOPROFEN | Drug Info | Discontinued in Phase 2 | Discovery agent | [3] | |
| Inhibitor | 2-(2-(2,5-dichlorophenylamino)phenyl)acetic acid | Drug Info | [4] | ||
| 2-(2-(2-chlorophenoxy)phenyl)acetic acid | Drug Info | [4] | |||
| 2-(2-(2-chlorophenylamino)phenyl)acetic acid | Drug Info | [4] | |||
| 2-(2-(2-fluorophenoxy)phenyl)acetic acid | Drug Info | [4] | |||
| 2-(2-(2-fluorophenylamino)phenyl)acetic acid | Drug Info | [4] | |||
| IBUPROPHEN | Drug Info | [4] | |||
| R-KETOPROFEN | Drug Info | [4] | |||
| Modulator | MDX-018 | Drug Info | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| Chemokine signaling pathway | |||||
| NF-kappa B signaling pathway | |||||
| Toll-like receptor signaling pathway | |||||
| NOD-like receptor signaling pathway | |||||
| RIG-I-like receptor signaling pathway | |||||
| Non-alcoholic fatty liver disease (NAFLD) | |||||
| Epithelial cell signaling in Helicobacter pylori infection | |||||
| Shigellosis | |||||
| Salmonella infection | |||||
| Pertussis | |||||
| Legionellosis | |||||
| Chagas disease (American trypanosomiasis) | |||||
| Malaria | |||||
| Amoebiasis | |||||
| Hepatitis C | |||||
| Hepatitis B | |||||
| Influenza A | |||||
| Pathways in cancer | |||||
| Transcriptional misregulation in cancer | |||||
| Bladder cancer | |||||
| Rheumatoid arthritis | |||||
| NetPath Pathway | IL-7 Signaling Pathway | ||||
| IL5 Signaling Pathway | |||||
| IL1 Signaling Pathway | |||||
| TSH Signaling Pathway | |||||
| IL2 Signaling Pathway | |||||
| IL3 Signaling Pathway | |||||
| IL4 Signaling Pathway | |||||
| TNFalpha Signaling Pathway | |||||
| TSLP Signaling Pathway | |||||
| TCR Signaling Pathway | |||||
| PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
| Interleukin signaling pathway | |||||
| CCKR signaling map ST | |||||
| Pathway Interaction Database | LPA receptor mediated events | ||||
| Calcineurin-regulated NFAT-dependent transcription in lymphocytes | |||||
| Validated transcriptional targets of AP1 family members Fra1 and Fra2 | |||||
| Glucocorticoid receptor regulatory network | |||||
| ATF-2 transcription factor network | |||||
| IL8-mediated signaling events | |||||
| AP-1 transcription factor network | |||||
| IL8- and CXCR2-mediated signaling events | |||||
| Regulation of nuclear beta catenin signaling and target gene transcription | |||||
| Syndecan-2-mediated signaling events | |||||
| Syndecan-3-mediated signaling events | |||||
| IL8- and CXCR1-mediated signaling events | |||||
| Reactome | Senescence-Associated Secretory Phenotype (SASP) | ||||
| Peptide ligand-binding receptors | |||||
| Chemokine receptors bind chemokines | |||||
| ATF4 activates genes | |||||
| G alpha (i) signalling events | |||||
| WikiPathways | Toll-like receptor signaling pathway | ||||
| SIDS Susceptibility Pathways | |||||
| Senescence and Autophagy in Cancer | |||||
| IL-3 Signaling Pathway | |||||
| Bladder Cancer | |||||
| Activation of Genes by ATF4 | |||||
| EBV LMP1 signaling | |||||
| Spinal Cord Injury | |||||
| Corticotropin-releasing hormone | |||||
| Allograft Rejection | |||||
| TSLP Signaling Pathway | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| Regulation of toll-like receptor signaling pathway | |||||
| References | |||||
| REF 1 | ClinicalTrials.gov (NCT00035828) A Blinded Study Comparing the Safety and Efficacy of a Fully Human Anti-IL8 Monoclonal Antibody (ABX-IL8) to Placebo in Patients With Chronic Bronchitis and COPD. U.S. National Institutes of Health. | ||||
| REF 2 | Clinical pipeline report, company report or official report of Genmab. | ||||
| REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007136) | ||||
| REF 4 | Bioorg Med Chem Lett. 2009 Aug 1;19(15):4026-30. Epub 2009 Jun 13.Structure-Activity Relationship of novel phenylacetic CXCR1 inhibitors. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.