Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T13409
|
||||
Former ID |
TTDI02209
|
||||
Target Name |
HIV p17 matrix protein
|
||||
Gene Name |
gag
|
||||
Synonyms |
gag
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | ||||
Function |
p6-gag: Plays a role in budding of the assembled particle by interacting with the host class E VPS proteins TSG101 and PDCD6IP/AIP1.
|
||||
UniProt ID | |||||
Sequence |
GARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQIL
GQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAAD TGHSNQVSQNY |
||||
Drugs and Mode of Action | |||||
Pathways | |||||
Reactome | Uncoating of the HIV Virion | ||||
Budding and maturation of HIV virion | |||||
Integration of provirus | |||||
Early Phase of HIV Life Cycle | |||||
Minus-strand DNA synthesis | |||||
Plus-strand DNA synthesis | |||||
2-LTR circle formation | |||||
Binding and entry of HIV virion | |||||
Membrane binding and targetting of GAG proteins | |||||
Assembly Of The HIV Virion | |||||
Integration of viral DNA into host genomic DNA | |||||
Autointegration results in viral DNA circles | |||||
APOBEC3G mediated resistance to HIV-1 infection | |||||
Vpr-mediated nuclear import of PICs | |||||
WikiPathways | Host Interactions of HIV factors | ||||
HIV Life Cycle | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.