Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T11253
|
||||
Former ID |
TTDC00269
|
||||
Target Name |
mRNA of Heatshock 27 kDa protein
|
||||
Gene Name |
HSPB1
|
||||
Synonyms |
28 kDa heat shock protein; Estrogen-regulated 24 kDa protein; HSP 27; Heat shock protein 27; HspB1; SRP27; Stress-responsive protein 27; HSPB1
|
||||
Target Type |
Discontinued
|
||||
Disease | Arthritis [ICD9: 710-719; ICD10: M00-M25] | ||||
Breast cancer; Ovarian cancer; Bladder cancer; Prostate cancer; Lung cancer [ICD9: 140-229, 162, 183, 188; ICD10: C00-C96, C33-C34, C56, C67] | |||||
Function |
Involved in stress resistance and actin organization.
|
||||
BioChemical Class |
Heat shock protein
|
||||
Target Validation |
T11253
|
||||
UniProt ID | |||||
Sequence |
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP
AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT IPVTFESRAQLGGPEAAKSDETAAK |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | MAPK signaling pathway | ||||
VEGF signaling pathway | |||||
Amoebiasis | |||||
Epstein-Barr virus infection | |||||
NetPath Pathway | EGFR1 Signaling Pathway | ||||
PANTHER Pathway | Angiogenesis | ||||
VEGF signaling pathway | |||||
p38 MAPK pathway | |||||
CCKR signaling map ST | |||||
Pathway Interaction Database | p38 signaling mediated by MAPKAP kinases | ||||
Signaling mediated by p38-alpha and p38-beta | |||||
Reactome | VEGFA-VEGFR2 Pathway | ||||
MAPK6/MAPK4 signaling | |||||
WikiPathways | p38 MAPK Signaling Pathway | ||||
MAPK Signaling Pathway | |||||
FAS pathway and Stress induction of HSP regulation | |||||
Apoptosis-related network due to altered Notch3 in ovarian cancer | |||||
Regulation of mRNA Stability by Proteins that Bind AU-rich Elements | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.