Target General Infomation
Target ID
T58238
Former ID
TTDS00453
Target Name
T-lymphocyte activation antigen CD80
Gene Name
CD80
Synonyms
Activation B7-1 antigen; B7; BB1; CD28LG; CD28LG1; CTLA-4 counter-receptor B7.1; LAB7; CD80
Target Type
Successful
Disease Autoimmune diabetes [ICD10: E08-E13]
Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86]
Non-small cell lung cancer [ICD10: C33-C34]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Transplant rejection [ICD9: 279.5, 996; ICD10: D89.8, T86]
Function
Involved in the costimulatory signal essential for T- lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation.
Target Validation
T58238
UniProt ID
Sequence
MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELA
QTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLK
YEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE
ELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFP
DNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV
Structure
1DR9; 1I8L
Drugs and Mode of Action
Drug(s) Abatacept Drug Info Approved Rheumatoid arthritis [1], [2]
RhuDex Drug Info Phase 2a Rheumatoid arthritis [3]
Galiximab Drug Info Phase 2 Lymphoma [4]
HS-110 Drug Info Phase 2 Non-small cell lung cancer [5]
MAXY-4 Drug Info Phase 1 Autoimmune diabetes [6]
Tolerimab (anti-CD80/CD86) Drug Info Terminated Transplant rejection [7]
Binder Abatacept Drug Info [8]
Inhibitor MAXY-4 Drug Info [9]
RhuDex Drug Info [10]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cell adhesion molecules (CAMs)
Toll-like receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Autoimmune thyroid disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
NetPath Pathway Leptin Signaling Pathway
RANKL Signaling Pathway
PANTHER Pathway T cell activation
Pathway Interaction Database TCR signaling in na&amp
#xef
ve CD4+ T cells
TCR signaling in na&amp
ve CD8+ T cells
IL12 signaling mediated by STAT4
Reactome PIP3 activates AKT signaling
Constitutive Signaling by Aberrant PI3K in Cancer
CD28 co-stimulation
CD28 dependent PI3K/Akt signaling
CD28 dependent Vav1 pathway
CTLA4 inhibitory signaling
WikiPathways Toll-like receptor signaling pathway
Inflammatory Response Pathway
PIP3 activates AKT signaling
Primary Focal Segmental Glomerulosclerosis FSGS
Allograft Rejection
Costimulation by the CD28 family
Regulation of toll-like receptor signaling pathway
References
REF 1Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54.
REF 2(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6891).
REF 3New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21.
REF 4ClinicalTrials.gov (NCT00516217) Galiximab in Treating Patients With Relapsed or Refractory Hodgkin's Lymphoma. U.S. National Institutes of Health.
REF 5ClinicalTrials.gov (NCT02117024) A Phase 2 Study of Viagenpumatucel-L (HS-110) in Patients With Non-Small Cell Lung Cancer. U.S. National Institutes of Health.
REF 6ClinicalTrials.gov (NCT02052375) A Study To Evaluate the Pharmacokinetics, Pharmacodynamics, Safety and Tolerability of ASP2408 After Multiple Dose Subcutaneous Injections in Patients With RheumatoidArthritis on Methotrexate. U.S. National Institutes of Health.
REF 7Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011393)
REF 8Selective modulation of T-cell co-stimulation: a novel mode of action for the treatment of rheumatoid arthritis. Clin Exp Rheumatol. 2009 May-Jun;27(3):510-8.
REF 9Trans-endocytosis of CD80 and CD86: a molecular basis for the cell-extrinsic function of CTLA-4. Science. 2011 Apr 29;332(6029):600-3.
REF 10A phase 1 study of AS1409, a novel antibody-cytokine fusion protein, in patients with malignant melanoma or renal cell carcinoma. Clin Cancer Res. 2011 Apr 1;17(7):1998-2005.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.