Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T25315
|
||||
Former ID |
TTDC00125
|
||||
Target Name |
C-X-C chemokine receptor type 3
|
||||
Gene Name |
CXCR3
|
||||
Synonyms |
CD183 antigen; CKR-L2; CXC-R3; CXCR-3; CXCR3/IP-10; Chemokine receptor CXCR3; Chemokine receptor CXCR3/interferon-inducible protein-10; Interferon-inducible protein 10 receptor; CXCR3
|
||||
Target Type |
Discontinued
|
||||
Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
Inflammatory disorder [ICD code not available] | |||||
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
Psoriatic disorder [ICD9: 696; ICD10: L40] | |||||
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
Function |
Isoform 3: Mediates theactivity of CXCL11.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T25315
|
||||
UniProt ID | |||||
Sequence |
MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALY
SLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFG SGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCL LFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILA VLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSET SEASYSGL |
||||
Drugs and Mode of Action | |||||
Antagonist | CXCR3 antagonists | Drug Info | [543922] | ||
CXCR3 antagonists | Drug Info | [543922] | |||
CXCR3 antagonists | Drug Info | [543922] | |||
dioscin | Drug Info | [527495] | |||
hypoglaucin A | Drug Info | [527495] | |||
kallstroemin D | Drug Info | [527495] | |||
NBI-74330 | Drug Info | [536059] | |||
Sch-900875 | Drug Info | [543922] | |||
T487 | Drug Info | [536005], [536059] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
Chemokine signaling pathway | |||||
NetPath Pathway | IL2 Signaling Pathway | ||||
PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
Pathway Interaction Database | CXCR3-mediated signaling events | ||||
Reactome | Chemokine receptors bind chemokines | ||||
G alpha (i) signalling events | |||||
WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
Peptide GPCRs | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
GPCRs, Other | |||||
References | |||||
Ref 527495 | Discovery of structurally diverse natural product antagonists of chemokine receptor CXCR3. Mol Divers. 2005;9(1-3):123-9. | ||||
Ref 536005 | FANCG is phosphorylated at serines 383 and 387 during mitosis. Mol Cell Biol. 2004 Oct;24(19):8576-85. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.