Target Information

Target General Infomation
Target ID
T19615
Former ID
TTDR01234
Target Name
Granulocyte colony-stimulating factor
Gene Name
CSF3
Synonyms
G-CSF; Lenograstim; Pluripoietin; CSF3
Target Type
Successful
Disease Aplastic anemia [ICD9: 284; ICD10: D60-D61]
Neutropenia; Breast cancer [ICD9: 174, 175; ICD10: C50]
Neutropenia [ICD9: 288; ICD10: D70]
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
BioChemical Class
Cytokine: interleukin
UniProt ID
P09919
Sequence
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA
LQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQG
LLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRR
AGGVLVASHLQSFLEVSYRVLRHLAQP
Structure
1HMC; 3UEZ; 3UF2; 4ADF; 4FA8; 1CD9; 1GNC; 1PGR; 1RHG; 2D9Q
Drugs and Mode of Action
Drug(s) Interleukin-3 Drug Info Approved Aplastic anemia [551871]
Neugranin Drug Info Preregistration Neutropenia [547546]
DA-3031 Drug Info Phase 3 Neutropenia [524038]
LA-EP2006 Drug Info Phase 3 Neutropenia [523772]
MK-4214 Drug Info Phase 3 Neutropenia [551956]
SPI-2012 Drug Info Phase 3 Neutropenia; Breast cancer [549072]
F-627 Drug Info Phase 2 Neutropenia [525287]
Modulator DA-3031 Drug Info [532495]
F-627 Drug Info [550803]
Interleukin-3 Drug Info [527761], [551871]
LA-EP2006 Drug Info [550486]
MK-4214 Drug Info
Neugranin Drug Info [544453]
SPI-2012 Drug Info
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
Malaria
NetPath Pathway IL1 Signaling Pathway
TNFalpha Signaling Pathway
TCR Signaling Pathway
WikiPathways Cytokines and Inflammatory Response
Hematopoietic Stem Cell Differentiation
References
Ref 523772ClinicalTrials.gov (NCT01516736) Phase III Study Comparing the Efficacy and Safety of LA-EP2006 and Peg-Filgrastim. U.S. National Institutes of Health.
Ref 524038ClinicalTrials.gov (NCT01674855) Phase III Study of DA-3031(PEG-G-CSF) in Chemotherapy-induced Neutropenia. U.S. National Institutes of Health.
Ref 525287ClinicalTrials.gov (NCT02521441) A Phase II, Dose-finding Study of F-627 in Patients With Breast Cancer Receiving Myelotoxic Chemotherapy.
Ref 547546Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017176)
Ref 549072Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031953)
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 551956Clinical pipeline report, company report or official report of Merck.
Ref 527761Interleukin 3: from colony-stimulating factor to pluripotent immunoregulatory cytokine. Int J Immunopharmacol. 1992 Apr;14(3):421-30.
Ref 532495Relationship between absolute neutrophil count profiles and pharmacokinetics of DA-3031, a pegylated granulocyte colony-stimulating factor (pegylated-G-CSF): a dose block-randomized, double-blind, dose-escalation study in healthy subjects. Clin Drug Investig. 2013 Nov;33(11):817-24.
Ref 544453Development and Characterization of a Novel Fusion Protein of a Mutated Granulocyte Colony-Stimulating Factor and Human Serum Albumin in Pichia pastoris. PLoS One. 2014; 9(12): e115840.
Ref 550486National Cancer Institute Drug Dictionary (drug id 724518).
Ref 550803Clinical pipeline report, company report or official report of Generon (Shanghai) Corporation Ltd.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.