Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T03313
|
||||
| Former ID |
TTDR01101
|
||||
| Target Name |
Interleukin-2 receptor alpha chain
|
||||
| Gene Name |
IL2RA
|
||||
| Synonyms |
CD25 antigen; IL-2 receptor alpha subunit; P55; TAC antigen; IL2RA
|
||||
| Target Type |
Successful
|
||||
| Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
| Chronic lymphocytic leukaemia [ICD10: C91] | |||||
| Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | |||||
| Heart transplant rejection [ICD9: 996; ICD10: T86] | |||||
| Hodgkin's lymphoma [ICD10: C81] | |||||
| Organ transplant rejection [ICD9: 279.5, 996; ICD10: D89.8, T86] | |||||
| Function |
Receptor for interleukin-2.
|
||||
| BioChemical Class |
Transmembrane protein
|
||||
| Target Validation |
T03313
|
||||
| UniProt ID | |||||
| Sequence |
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Basiliximab | Drug Info | Approved | Organ transplant rejection | [536361], [541935] |
| Inolimomab | Drug Info | Phase 3 | Heart transplant rejection | [537129] | |
| LMB-2 | Drug Info | Phase 2 | Chronic lymphocytic leukaemia | [525749] | |
| RFT-5.dgA | Drug Info | Phase 2 | Human immunodeficiency virus infection | [522307] | |
| CHT-25 | Drug Info | Phase 1 | Hodgkin's lymphoma | [530581] | |
| HuMax-TAC | Drug Info | Terminated | Autoimmune diabetes | [547655] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| Endocytosis | |||||
| PI3K-Akt signaling pathway | |||||
| Jak-STAT signaling pathway | |||||
| Hematopoietic cell lineage | |||||
| Measles | |||||
| HTLV-I infection | |||||
| NetPath Pathway | IL5 Signaling Pathway | ||||
| TCR Signaling Pathway | |||||
| IL2 Signaling Pathway | |||||
| TNFalpha Signaling Pathway | |||||
| Leptin Signaling Pathway | |||||
| PANTHER Pathway | Interleukin signaling pathway | ||||
| Pathway Interaction Database | IL12-mediated signaling events | ||||
| Calcineurin-regulated NFAT-dependent transcription in lymphocytes | |||||
| Arf6 trafficking events | |||||
| SHP2 signaling | |||||
| IL2-mediated signaling events | |||||
| IL2 signaling events mediated by PI3K | |||||
| IL2 signaling events mediated by STAT5 | |||||
| Calcium signaling in the CD4+ TCR pathway | |||||
| Downstream signaling in na& | |||||
| #xef | |||||
| ve CD8+ T cells | |||||
| IL12 signaling mediated by STAT4 | |||||
| Reactome | GPVI-mediated activation cascade | ||||
| gamma signalling through PI3Kgamma | |||||
| Interleukin-2 signaling | |||||
| RAF/MAP kinase cascade | |||||
| Interleukin receptor SHC signaling | |||||
| WikiPathways | IL-2 Signaling Pathway | ||||
| Inflammatory Response Pathway | |||||
| Interleukin-2 signaling | |||||
| Allograft Rejection | |||||
| TSLP Signaling Pathway | |||||
| IL-7 Signaling Pathway | |||||
| Interleukin-3, 5 and GM-CSF signaling | |||||
| References | |||||
| Ref 522307 | ClinicalTrials.gov (NCT00667017) RFT5-dgA Immunotoxin in Treating Patients With Relapsed or Refractory Cutaneous T-Cell Non-Hodgkin Lymphoma. U.S. National Institutes of Health. | ||||
| Ref 525749 | Phase I trial of recombinant immunotoxin anti-Tac(Fv)-PE38 (LMB-2) in patients with hematologic malignancies. J Clin Oncol. 2000 Apr;18(8):1622-36. | ||||
| Ref 530581 | A Phase I Clinical Trial of CHT-25 a 131I-Labeled Chimeric Anti-CD25 Antibody Showing Efficacy in Patients with Refractory Lymphoma. Clin Cancer Res. 2009 Dec 15;15(24):7701-7710. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 537129 | New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21. | ||||
| Ref 525375 | Biosynthesis, synthesis, and biological activities of pyrrolobenzodiazepines. Med Res Rev. 2012 Mar;32(2):254-93. doi: 10.1002/med.20212. Epub 2010 Jun 13. | ||||
| Ref 525749 | Phase I trial of recombinant immunotoxin anti-Tac(Fv)-PE38 (LMB-2) in patients with hematologic malignancies. J Clin Oncol. 2000 Apr;18(8):1622-36. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.