Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T10513
|
||||
Former ID |
TTDR01170
|
||||
Target Name |
Integrin beta-2
|
||||
Gene Name |
ITGB2
|
||||
Synonyms |
CD18; Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta; Complement receptor C3 subunit beta; Integrin alpha-M/beta-2; ITGB2
|
||||
Target Type |
Discontinued
|
||||
Disease | Cerebrovascular ischaemia [ICD9: 434.91; ICD10: I61-I63] | ||||
Stroke [ICD9: 434.91, 437.6, 453, 671.5, 671.9; ICD10: I61-I63, I80-I82] | |||||
Function |
Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrins alpha-M/beta-2 and alpha-X/beta-2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin alpha-X/beta-2 recognizes thesequence G-P-R in fibrinogen alpha-chain. Integrin alpha-M/beta-2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin alpha-M/beta-2 is also a receptor for factor X. Integrin alpha- D/beta-2 is a receptor for ICAM3 and VCAM1. Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation.
|
||||
BioChemical Class |
Integrin
|
||||
Target Validation |
T10513
|
||||
UniProt ID | |||||
Sequence |
MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFR RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFV NTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAM MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFD YPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAY NKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKN CECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTIN CERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNV CECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGR TCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLL VIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES |
||||
Structure |
1A8X; 1BHO; 1BHQ; 1IDN; 1IDO; 1JLM; 1M1U; 1MF7; 1N9Z; 1NA5; 2LKE; 2LKJ; 3Q3G; 3QA3; 4M76; 1JX3; 1L3Y; 1YUK; 2JF1; 2P26; 2P28; 2V7D; 3K6S; 3K71; 3K72; 4NEH; 4NEN
|
||||
Drugs and Mode of Action | |||||
Pathways | |||||
KEGG Pathway | Rap1 signaling pathway | ||||
Phagosome | |||||
Hippo signaling pathway | |||||
Cell adhesion molecules (CAMs) | |||||
Natural killer cell mediated cytotoxicity | |||||
Leukocyte transendothelial migration | |||||
Regulation of actin cytoskeleton | |||||
Pertussis | |||||
Legionellosis | |||||
Leishmaniasis | |||||
Malaria | |||||
Amoebiasis | |||||
Staphylococcus aureus infection | |||||
Tuberculosis | |||||
HTLV-I infection | |||||
Rheumatoid arthritis | |||||
Viral myocarditis | |||||
NetPath Pathway | IL5 Signaling Pathway | ||||
TCR Signaling Pathway | |||||
IL2 Signaling Pathway | |||||
PANTHER Pathway | Integrin signalling pathway | ||||
Pathway Interaction Database | Integrin family cell surface interactions | ||||
amb2 Integrin signaling | |||||
Beta2 integrin cell surface interactions | |||||
Urokinase-type plasminogen activator (uPA) and uPAR-mediated signaling | |||||
CXCR3-mediated signaling events | |||||
HIF-1-alpha transcription factor network | |||||
Reactome | Toll Like Receptor 4 (TLR4) Cascade | ||||
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | |||||
Cell surface interactions at the vascular wall | |||||
Integrin cell surface interactions | |||||
WikiPathways | Focal Adhesion | ||||
Human Complement System | |||||
Toll-Like Receptors Cascades | |||||
Integrin-mediated Cell Adhesion | |||||
Integrin cell surface interactions | |||||
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | |||||
Cell surface interactions at the vascular wall | |||||
References | |||||
Ref 526034 | J Med Chem. 2001 Apr 12;44(8):1202-10.Novel p-arylthio cinnamides as antagonists of leukocyte function-associated antigen-1/intracellular adhesion molecule-1 interaction. 2. Mechanism of inhibition and structure-based improvement of pharmaceutical properties. | ||||
Ref 528539 | J Med Chem. 2006 Nov 30;49(24):6946-9.Discovery and development of 5-[(5S,9R)-9-(4-cyanophenyl)-3-(3,5-dichlorophenyl)-1-methyl-2,4-dioxo-1,3,7-triazaspiro[4.4]non-7-yl-methyl]-3-thiophenecarboxylic acid (BMS-587101)--a small molecule antagonist of leukocyte function associated antigen-1. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.