Target General Infomation
Target ID
T00420
Former ID
TTDI02157
Target Name
HIV REV protein
Gene Name
rev
Synonyms
ART/TRS; Anti-repression transactivator; Regulator of expression of viral proteins; rev
Target Type
Clinical Trial
Disease Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26]
Function
Escorts unspliced or incompletely spliced viral pre- mRNAs (late transcripts) out of the nucleus of infected cells. These pre-mRNAs carry a recognition sequence called Rev responsive element (RRE) located in the env gene, that is not present in fully spliced viral mRNAs (early transcripts). This function is essential since most viral proteins are translated from unspliced or partially spliced pre-mRNAs which cannot exit the nucleus by the pathway used by fully processed cellular mRNAs. Rev itself is translated from a fully spliced mRNA that readily exits the nucleus. Rev's nuclear localization signal (NLS) bindsdirectly to KPNB1/Importin beta-1 without previous binding to KPNA1/Importin alpha-1. KPNB1 binds to the GDP bound form of RAN (Ran-GDP) and targets Rev to the nucleus. In the nucleus, the conversionfrom Ran-GDP to Ran-GTP dissociates Rev from KPNB1 and allows Rev's binding to the RRE in viral pre-mRNAs. Rev multimerization on the RRE via cooperative assembly exposes its nuclear export signal (NES) to the surface. Rev can then form a complex with XPO1/CRM1 and Ran-GTP, leading to nuclear export of the complex. Conversion from Ran-GTP to Ran-GDP mediates dissociation of the Rev/RRE/XPO1/RAN complex, so that Rev can return to the nucleus for a subsequent round of export. Beside KPNB1, also seems to interact with TNPO1/Transportin-1, RANBP5/IPO5 and IPO7/RANBP7 for nuclear import. The nucleoporin-like HRB/RIP is an essential cofactor that probably indirectly interacts with Rev to release HIV RNAs from the perinuclear region to the cytoplasm (By similarity). Interacts with DDX1; the interaction is necessary for proper subcellular localization of this protein.
BioChemical Class
HIV-1 REV
UniProt ID
Sequence
MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERIL
GTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE
Drugs and Mode of Action
Drug(s) Ad35-GRIN/ENV Drug Info Phase 1 Human immunodeficiency virus infection [523741]
ATI-0917 Drug Info Phase 1 Human immunodeficiency virus infection [530051]
Inhibitor ATI-0917 Drug Info [530051]
Pathways
Reactome Uncoating of the HIV Virion
Budding and maturation of HIV virion
Integration of provirus
Early Phase of HIV Life Cycle
Minus-strand DNA synthesis
Plus-strand DNA synthesis
2-LTR circle formation
Binding and entry of HIV virion
Assembly Of The HIV Virion
Integration of viral DNA into host genomic DNA
Autointegration results in viral DNA circles
APOBEC3G mediated resistance to HIV-1 infection
Vpr-mediated nuclear import of PICs
WikiPathways Host Interactions of HIV factors
HIV Life Cycle
References
Ref 523741ClinicalTrials.gov (NCT01496989) Safety and Immunogenicity Study of HIV-MAG Vaccine +/- IL-12 and Ad35-GRIN/ENV in HIV-uninfected Volunteers. U.S. National Institutes of Health.
Ref 530051Antiretroviral drugs in development. A report from HIV DART 2008: Frontiers in Drug Development for Antiretroviral Therapies, 9-12 December 2008, Rio Grande, Puerto Rico. Expert Opin Investig Drugs. 2009 Apr;18(4):549-53.
Ref 530051Antiretroviral drugs in development. A report from HIV DART 2008: Frontiers in Drug Development for Antiretroviral Therapies, 9-12 December 2008, Rio Grande, Puerto Rico. Expert Opin Investig Drugs. 2009 Apr;18(4):549-53.
Ref 531994A phase I double blind, placebo-controlled, randomized study of a multigenic HIV-1 adenovirus subtype 35 vector vaccine in healthy uninfected adults. PLoS One. 2012;7(8):e41936.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.