Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T75570
|
||||
Former ID |
TTDS00408
|
||||
Target Name |
Proto-oncogene tyrosine-protein kinase Yes
|
||||
Gene Name |
YES1
|
||||
Synonyms |
FYN; Protooncogene Syn; SLK; p59-Fyn; YES1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
Function |
Non-receptor protein tyrosine kinase that is involved in the regulation of cell growth and survival, apoptosis, cell-cell adhesion, cytoskeleton remodeling, and differentiation. Stimulation by receptortyrosine kinases (RTKs) including EGRF, PDGFR, CSF1R and FGFR leads to recruitment of YES1 to the phosphorylated receptor, and activation and phosphorylation of downstream substrates. Upon EGFR activation, promotes the phosphorylation of PARD3 to favor epithelial tight junction assembly. Participates in the phosphorylation of specific junctional components such as CTNND1 by stimulating the FYN and FER tyrosine kinases at cell-cell contacts. Upon T-cell stimulation by CXCL12, phosphorylates collapsin response mediator protein 2/DPYSL2 and induces T-cell migration. Participates in CD95L/FASLG signaling pathway and mediates AKT-mediated cell migration. Plays a role in cell cycle progression by phosphorylating the cyclin-dependent kinase 4/CDK4 thus regulating the G1 phase. Also involved in G2/M progression and cytokinesis.
|
||||
BioChemical Class |
Kinase
|
||||
Target Validation |
T75570
|
||||
UniProt ID | |||||
EC Number |
EC 2.7.10.2
|
||||
Sequence |
MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMT
PFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQI INNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRG IFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHY TEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTT KVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFL KEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARL IEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNRE VLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPG ENL |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Adherens junction | ||||
Tight junction | |||||
NetPath Pathway | IL5 Signaling Pathway | ||||
IL2 Signaling Pathway | |||||
PANTHER Pathway | Cadherin signaling pathway | ||||
Parkinson disease | |||||
CCKR signaling map ST | |||||
Pathway Interaction Database | Noncanonical Wnt signaling pathway | ||||
Glypican 1 network | |||||
Signaling events mediated by PTP1B | |||||
Regulation of p38-alpha and p38-beta | |||||
CDC42 signaling events | |||||
Thromboxane A2 receptor signaling | |||||
Netrin-mediated signaling events | |||||
CXCR4-mediated signaling events | |||||
Class I PI3K signaling events | |||||
amb2 Integrin signaling | |||||
EPHA forward signaling | |||||
PDGFR-beta signaling pathway | |||||
Ephrin B reverse signaling | |||||
Alpha-synuclein signaling | |||||
Signaling events mediated by focal adhesion kinase | |||||
Reactome | Regulation of KIT signaling | ||||
FCGR activation | |||||
PECAM1 interactions | |||||
EPH-Ephrin signaling | |||||
CD28 co-stimulation | |||||
CTLA4 inhibitory signaling | |||||
EPHB-mediated forward signaling | |||||
EPHA-mediated growth cone collapse | |||||
EPH-ephrin mediated repulsion of cells | |||||
Regulation of signaling by CBL | |||||
WikiPathways | Signaling by SCF-KIT | ||||
Interleukin-11 Signaling Pathway | |||||
TSLP Signaling Pathway | |||||
Costimulation by the CD28 family | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.