Target Information

Target General Information

Top

Target ID

T98539 (Former ID: TTDI02502)

Target Name

Tie-1 tyrosine kinase receptor (TIE1)

Synonyms

Tyrosine-protein kinase receptor Tie-1; TIE1

Click to Show/Hide

Gene Name

TIE1

Target Type

Literature-reported target

[1]

Function

Transmembrane tyrosine-protein kinase that may modulate TEK/TIE2 activity and contribute to the regulation of angiogenesis.

Click to Show/Hide

BioChemical Class

Kinase

UniProt ID

TIE1_HUMAN

EC Number

EC 2.7.10.1

Sequence

MVWRVPPFLLPILFLASHVGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPP
LLLEKDDRIVRTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVH
NSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLL
QLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDH
DGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGS
QCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASEL
EFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLAD
SGFWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISTV
RLHYRPQDSTMDWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTT
DCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSP
QARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEI
QLTWKHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRMRA
SIQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVSATCLTILAAL
LTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKLQPEPLSYPVLEWEDIT
FEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNI
INLLGACKNRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFA
SDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWM
AIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDD
EVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues. The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021). Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database. The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017). Human Similarity Proteins Human Tissue Distribution Biological Network Descriptors

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.

The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021).

Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.

The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017).

Human Similarity Proteins

Human Tissue Distribution

Biological Network Descriptors

Protein Name	Pfam ID	Percentage of Identity (%)	E value
Mixed lineage kinase 1 (MAP3K9)	PF00069 ; PF14604	30.872 (92/298)	1.80E-27
Aurora kinase C (AURKC)	PF00069	28.269 (80/283)	5.68E-22
Platelet endothelial aggregation receptor 1 (PEAR1)	PF00053	42.748 (56/131)	5.12E-21
Aurora kinase B (AURKB)	PF00069	28.253 (76/269)	2.88E-20
Multiple epidermal growth factor-like domains protein 11 (MEGF11)	PF12661 ; PF00053	44.030 (59/134)	3.09E-19
Serine/threonine-protein kinase Nek4 (NEK4)	PF00069	26.460 (77/291)	8.19E-19
Multiple epidermal growth factor-like domains protein 10 (MEGF10)	PF12661 ; PF00053	41.176 (56/136)	1.04E-18
Multiple epidermal growth factor-like domains protein 6 (MEGF6)	PF07645 ; PF14670 ; PF12661 ; PF00053 More >>	44.286 (62/140)	1.21E-18
Leucine-rich repeat kinase 2 (LRRK2)	PF16095 ; PF12799 ; PF13855 ; PF00069 ; PF08477 More >>	29.617 (85/287)	1.46E-18
Aurora kinase A (AURKA)	PF00069	25.000 (67/268)	8.47E-18
Myosin light chain kinase 3 (MYLK3)	PF00069	27.027 (70/259)	1.18E-17
Serine/threonine-protein kinase Nek5 (NEK5)	PF00069	23.664 (62/262)	1.47E-17
Microtubule affinity regulating kinase 3 (MARK3)	PF02149 ; PF00069 ; PF00627 More >>	29.924 (79/264)	2.07E-17
NUAK family SNF1-like kinase 2 (NUAK2)	PF00069	28.216 (68/241)	2.78E-17
Unc-51 like kinase 3 (ULK3)	PF04212 ; PF00069	25.926 (70/270)	3.28E-17
Serine/threonine-protein kinase MARK2 (MARK2)	PF02149 ; PF00069 ; PF00627 More >>	28.873 (82/284)	3.39E-17
NIMA-related kinase 6 (NEK6)	PF00069	25.321 (79/312)	3.45E-17
Serine/threonine-protein kinase MARK1 (MARK1)	PF02149 ; PF00069 ; PF00627 More >>	30.380 (72/237)	3.72E-17
Omphalocele kinase 1 (NUAK1)	PF00069	28.870 (69/239)	4.31E-17
Polo-like kinase 4 (PLK4)	PF00069 ; PF18190 ; PF18409 More >>	27.306 (74/271)	5.41E-17
Scavenger receptor class F member 1 (SCARF1)	PF00053	42.963 (58/135)	6.50E-17
Serine/threonine-protein kinase Nek3 (NEK3)	PF00069	23.792 (64/269)	7.28E-17
cAMP-dependent protein kinase catalytic subunit PRKX (PRKX)	PF00069	25.373 (68/268)	1.08E-16
MAP/microtubule affinity-regulating kinase 4 (MARK4)	PF02149 ; PF00069 ; PF00627 More >>	28.788 (76/264)	1.61E-16
TRAF2 and NCK interacting kinase (TNIK)	PF00780 ; PF00069	27.273 (63/231)	1.67E-16
Serine/threonine-protein kinase Nek8 (NEK8)	PF00069 ; PF00415	25.094 (67/267)	1.97E-16
Protein kinase C theta (PRKCQ)	PF00130 ; PF00069 ; PF00433 More >>	26.855 (76/283)	3.34E-16
Serine/threonine-protein kinase NIM1 (NIM1K)	PF00069	29.389 (77/262)	3.46E-16
NIMA-related kinase 7 (NEK7)	PF00069	24.080 (72/299)	6.40E-16
Ribosomal protein S6 kinase alpha-1 (RSK1)	PF00069 ; PF00433	25.581 (66/258)	9.15E-16
Ribosomal protein S6 kinase alpha-3 (RSK3)	PF00069 ; PF00433	25.969 (67/258)	1.21E-15
Calcium/calmodulin-dependent protein kinase type 1 (CAMK1)	PF00069	27.652 (73/264)	1.30E-15
Proto-oncogene serine/threonine-protein kinase mos (MOS)	PF00069	24.916 (74/297)	1.41E-15
Serine/threonine-protein kinase ULK1 (ULK1)	PF12063 ; PF00069	25.820 (63/244)	1.57E-15
Serine/threonine-protein kinase 10 (STK10)	PF00069 ; PF12474	32.110 (70/218)	1.76E-15
SPS1/STE20-related protein kinase YSK4 (YSK4)	PF00069	24.908 (68/273)	2.25E-15
Serine/threonine-protein kinase 24 (STK24)	PF00069	25.442 (72/283)	2.59E-15
NIMA-related kinase 2 (NEK2)	PF00069	29.368 (79/269)	5.32E-15
Serine/threonine-protein kinase Sgk2 (SGK2)	PF00069 ; PF00433	26.033 (63/242)	7.92E-15
Salt-inducible kinase 2 (SIK2)	PF00069	27.306 (74/271)	8.72E-15
Putative serine/threonine-protein kinase SIK1B (SIK1B)	PF00069	26.493 (71/268)	9.45E-15
Salt-inducible kinase 1 (SIK1)	PF00069	26.493 (71/268)	9.70E-15
IL-1 receptor-associated kinase 1 (IRAK1)	PF00531 ; PF00069	27.572 (67/243)	1.22E-14
Ribosomal protein S6 kinase alpha-2 (RSK2)	PF00069 ; PF00433	25.581 (66/258)	1.26E-14
Oxidative stress responsive 1 (OXSR1)	PF12202 ; PF00069	26.549 (60/226)	1.27E-14
Protein kinase N1 (PKN1)	PF02185 ; PF00069 ; PF00433 More >>	26.182 (72/275)	1.43E-14
Serine/threonine-protein kinase 25 (STK25)	PF00069	30.732 (63/205)	1.48E-14
Calmodulin-dependent kinase II (CAMKK2)	PF00069	25.153 (82/326)	1.53E-14
Putative 3-phosphoinositide-dependent protein kinase 2 (PDPK2P)	PF00069	25.806 (56/217)	1.78E-14
Fused homolog (STK36)	PF13646 ; PF00069	25.561 (57/223)	2.86E-14
MST-1 protein kinase (STK4)	PF11629 ; PF00069	23.774 (63/265)	2.97E-14
Misshapen-like kinase 1 (MINK1)	PF00780 ; PF00069	28.326 (66/233)	3.18E-14
Calcium/calmodulin-dependent protein kinase type 1G (CAMK1G)	PF00069	28.326 (66/233)	3.30E-14
SIK family kinase 3 (SIK3)	PF00069	28.464 (76/267)	3.51E-14
Putative EGF-like and EMI domain-containing protein 1 (EGFEM1P)		29.921 (38/127)	3.60E-14
Protein kinase C beta (PRKCB)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	25.926 (70/270)	3.82E-14
Protein kinase C delta (PRKCD)	PF00130 ; PF00069 ; PF00433 More >>	26.217 (70/267)	4.30E-14
Testis-specific serine kinase 2 (TSSK2)	PF00069	25.000 (65/260)	6.34E-14
Cytoplasmic DRAK1 (STK17A)	PF00069	26.236 (69/263)	7.08E-14
Protein kinase C alpha (PRKCA)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	24.621 (65/264)	7.61E-14
Phosphoinositide dependent protein kinase-1 (PDPK1)	PF14593 ; PF00069	25.806 (56/217)	8.18E-14
Putative serine/threonine-protein kinase PRKY (PRKY)	PF00069	25.833 (62/240)	8.51E-14
Testis-specific serine/threonine-protein kinase 1 (TSSK1B)	PF00069	25.194 (65/258)	9.63E-14
Ribosomal protein S6 kinase alpha-6 (RSK6)	PF00069 ; PF00433	26.641 (69/259)	1.49E-13
MEK kinase kinase 4 (MAP4K4)	PF00780 ; PF00069	26.407 (61/231)	1.58E-13
Tyrosine-protein kinase EIF2AK2 (p68)	PF00035 ; PF00069	24.138 (70/290)	2.28E-13
Serine/threonine-protein kinase H2 (PSKH2)	PF00069	28.125 (72/256)	2.56E-13
Cyclin-dependent kinase 3 (CDK3)	PF00069	27.670 (57/206)	3.10E-13
Serine/threonine-protein kinase 17B (STK17B)	PF00069	26.296 (71/270)	3.25E-13
Serine/threonine-protein kinase Sgk1 (SGK1)	PF00069 ; PF00433	26.230 (64/244)	3.37E-13
Serine/threonine-protein kinase ULK2 (ULK2)	PF12063 ; PF00069	25.092 (68/271)	3.39E-13
Serine/threonine-protein kinase 3 (STK3)	PF11629 ; PF00069	23.019 (61/265)	3.41E-13
Protein kinase G1 (PRKG1)	PF00027 ; PF16808 ; PF00069 More >>	23.102 (70/303)	3.65E-13
Myosin light chain kinase family member 4 (MYLK4)	PF00069	26.697 (59/221)	4.08E-13
Serine/threonine-protein kinase H1 (PSKH1)	PF00069	27.778 (65/234)	4.28E-13
Serine/threonine-protein kinase 26 (STK26)	PF00069	24.028 (68/283)	4.53E-13
Myosin light chain kinase 2 (MYLK2)	PF00069	25.000 (64/256)	6.39E-13
Serine/threonine-protein kinase SBK1 (SBK1)	PF00069	26.432 (60/227)	6.72E-13
PAK-2 protein kinase (PAK2)	PF00786 ; PF00069	27.570 (59/214)	7.32E-13
Serine/threonine-protein kinase Nek11 (NEK11)	PF00069	24.906 (66/265)	7.90E-13
BR serine/threonine kinase 1 (BRSK1)	PF00069	24.719 (66/267)	8.77E-13
Serine/threonine-protein kinase PAK 6 (PAK6)	PF00786 ; PF00069	24.554 (55/224)	9.00E-13
Protein kinase C eta type (PRKCH)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	26.496 (62/234)	1.05E-12
Hormonally up-regulated neu tumor-associated kinase (HUNK)	PF00069	25.338 (75/296)	1.14E-12
Scavenger receptor class F member 2 (SCARF2)	PF00053	38.346 (51/133)	1.16E-12
5'-AMP-activated protein kinase catalytic subunit alpha-1 (PRKAA1)	PF16579 ; PF00069	25.379 (67/264)	1.37E-12
Death-associated protein kinase 2 (DAPK2)	PF00069	28.063 (71/253)	1.59E-12
Receptor-interacting serine/threonine-protein kinase 3 (RIPK3)	PF00069 ; PF12721	24.776 (83/335)	1.79E-12
PAK-1 protein kinase (PAK1)	PF00786 ; PF00069	25.701 (55/214)	2.10E-12
Cyclin-dependent kinase 7 (CDK7)	PF00069	27.488 (58/211)	2.21E-12
Serine/threonine-protein kinase 33 (STK33)	PF00069	26.749 (65/243)	2.30E-12
Death-associated protein kinase 1 (DAPK1)	PF00023 ; PF12796 ; PF13637 ; PF00531 ; PF00069 More >>	27.826 (64/230)	2.72E-12
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2)	PF16579 ; PF00069	25.000 (66/264)	3.08E-12
Serine/threonine-protein kinase Sgk3 (SGK3)	PF00069 ; PF00433 ; PF00787 More >>	23.377 (54/231)	3.19E-12
Cyclin-dependent kinase 12 (CDK12)	PF00069	26.971 (65/241)	3.40E-12
Inhibitor of nuclear factor kappa-B kinase alpha (IKKA)	PF18397 ; PF12179 ; PF00069 More >>	26.957 (62/230)	3.67E-12
BR serine/threonine kinase 2 (BRSK2)	PF00069	25.962 (54/208)	3.71E-12
Polo-like kinase 2 (PLK2)	PF00069 ; PF00659	22.901 (60/262)	5.05E-12
NIMA-related kinase 1 (NEK1)	PF00069	23.574 (62/263)	5.17E-12
Ste-20-related kinase (STK39)	PF12202 ; PF00069	23.630 (69/292)	5.76E-12
cAMP-dependent protein kinase catalytic subunit gamma (PRKACG)	PF00069	25.197 (64/254)	5.92E-12
Leucine-rich repeat serine/threonine-protein kinase 1 (LRRK1)	PF12796 ; PF16095 ; PF00069 ; PF08477 More >>	26.621 (78/293)	6.10E-12
Cyclin-dependent kinase-like 3 (CDKL3)	PF00069	24.528 (52/212)	6.77E-12
Dual specificity mitogen-activated protein kinase kinase 4 (MAP2K4)	PF00069	26.136 (69/264)	6.78E-12
MEK kinase kinase 3 (MAP4K3)	PF00780 ; PF00069	27.854 (61/219)	7.13E-12
Serine/threonine-protein kinase PAK 3 (PAK3)	PF00786 ; PF00069	25.701 (55/214)	7.28E-12
Cyclin-dependent kinase 2 (CDK2)	PF00069	27.670 (57/206)	8.81E-12
Calcium/calmodulin-dependent protein kinase type II subunit gamma (CAMK2G)	PF08332 ; PF00069	26.582 (63/237)	1.09E-11
Cyclin-dependent kinase 13 (CDK13)	PF12330 ; PF00069	28.634 (65/227)	1.29E-11
Serine/threonine-protein kinase PAK 5 (PAK5)	PF00786 ; PF00069	25.000 (53/212)	1.36E-11
Protein kinase N3 (PKN3)	PF02185 ; PF00069 ; PF00433 More >>	26.538 (69/260)	1.43E-11
Inhibitor of nuclear factor kappa-B kinase beta (IKKB)	PF18397 ; PF12179 ; PF00069 More >>	26.316 (60/228)	1.69E-11
STE20-related serine/threonine-protein kinase (SLK)	PF00069 ; PF12474	28.910 (61/211)	1.82E-11
Protein kinase C gamma (PRKCG)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	26.423 (65/246)	1.98E-11
Protein kinase N2 (PKN2)	PF02185 ; PF00069 ; PF00433 More >>	25.869 (67/259)	2.10E-11
MAPK/MAK/MRK overlapping kinase (MOK)	PF00069	26.190 (55/210)	2.17E-11
Cyclin-dependent kinase-like 2 (CDKL2)	PF00069	26.263 (78/297)	2.56E-11
Cyclin-dependent kinase 9 (CDK9)	PF00069	29.412 (50/170)	2.70E-11
TGF-beta receptor type I (TGFBR1)	PF01064 ; PF00069 ; PF08515 More >>	21.608 (86/398)	2.79E-11
Mitogen-activated protein kinase 15 (MAPK15)	PF00069	26.728 (58/217)	2.79E-11
Serine/threonine-protein kinase Nek9 (NEK9)	PF00069 ; PF00415	23.846 (62/260)	3.09E-11
Calcium/calmodulin-dependent protein kinase type 1D (CAMK1D)	PF00069	28.674 (80/279)	3.48E-11
Stabilin-2 (STAB2)	PF12947 ; PF02469 ; PF00193 More >>	34.266 (49/143)	3.65E-11
MEK kinase kinase 1 (MAP4K1)	PF00780 ; PF00069	22.989 (60/261)	3.88E-11
Nik-related protein kinase (NRK)	PF00780 ; PF00069	24.324 (63/259)	4.25E-11
Ribosomal protein S6 kinase beta-1 (S6K1)	PF00069 ; PF00433	23.137 (59/255)	5.18E-11
Laminin subunit alpha-5 (LAMA5)	PF00052 ; PF00053 ; PF00054 ; PF02210 ; PF06008 ; PF06009 ; PF00055 More >>	38.462 (50/130)	5.36E-11
von Willebrand factor D and EGF domain-containing protein (VWDE)	PF00094	36.306 (57/157)	5.96E-11
cAMP-dependent protein kinase catalytic subunit beta (PRKACB)	PF00069	23.256 (60/258)	6.19E-11
Mitogen-activated protein kinase kinase kinase 15 (MAP3K15)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	25.676 (76/296)	6.31E-11
Dual-specificity tyrosine-phosphorylation regulated kinase 3 (DYRK3)	PF00069	26.389 (57/216)	6.51E-11
Protein kinase C epsilon (PRKCE)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	25.424 (60/236)	8.97E-11
PDZ binding kinase (PBK)	PF00069	26.437 (69/261)	9.96E-11
ERK activator kinase 5 (MAP2K5)	PF00564 ; PF00069	26.354 (73/277)	1.02E-10
Protocadherin Fat 4 (FAT4)	PF00028 ; PF07645 ; PF12661 ; PF02210 More >>	32.143 (45/140)	1.11E-10
Extracellular signal-regulated kinase 5 (ERK5)	PF00069	27.313 (62/227)	1.30E-10
Polo-like kinase 1 (PLK1)	PF00069 ; PF00659	24.402 (51/209)	1.31E-10
Activin receptor type IB (ACVR1B)	PF01064 ; PF00069 ; PF08515 More >>	24.262 (74/305)	1.74E-10
Cyclin-dependent kinase 6 (CDK6)	PF00069	28.230 (59/209)	1.92E-10
RAC-alpha serine/threonine-protein kinase (AKT1)	PF00169 ; PF00069 ; PF00433 More >>	25.660 (68/265)	2.32E-10
Peripheral plasma membrane protein CASK (CASK)	PF00625 ; PF02828 ; PF00595 ; PF00069 ; PF00018 More >>	27.240 (76/279)	2.55E-10
Death-associated protein kinase 3 (DAPK3)	PF00069	26.316 (60/228)	2.67E-10
Myosin-IIIb (MYO3B)	PF00612 ; PF00063 ; PF00069 More >>	25.352 (72/284)	2.70E-10
ERK activator kinase 1 (MEK1)	PF00069	27.907 (60/215)	2.73E-10
Serine/threonine-protein kinase Nek10 (NEK10)	PF00069	23.237 (56/241)	3.01E-10
Protein kinase C iota (PRKCI)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	23.982 (53/221)	3.06E-10
Cyclin-dependent kinase 1 (CDK1)	PF00069	24.766 (53/214)	3.70E-10
Membrane-associated kinase (PKMYT1)	PF00069	24.561 (56/228)	3.77E-10
Serine/threonine-protein kinase PLK3 (PLK3)	PF00069 ; PF00659	23.282 (61/262)	3.78E-10
Myosin-IIIa (MYO3A)	PF00612 ; PF00063 ; PF00069 More >>	24.221 (70/289)	4.01E-10
ERK activator kinase 2 (MEK2)	PF00069	27.907 (60/215)	4.23E-10
RAC-gamma serine/threonine-protein kinase (AKT3)	PF00169 ; PF00069 ; PF00433 More >>	24.454 (56/229)	5.61E-10
RAC-beta serine/threonine-protein kinase (AKT2)	PF00169 ; PF00069 ; PF00433 More >>	24.335 (64/263)	5.64E-10
PAK-4 protein kinase (PAK4)	PF00786 ; PF00069	26.415 (56/212)	6.70E-10
MAPK/ERK kinase kinase 3 (MAP3K3)	PF00564 ; PF00069	26.415 (56/212)	7.04E-10
Ribosomal protein S6 kinase beta-2 (RPS6KB2)	PF00069 ; PF00433	21.538 (56/260)	7.65E-10
cAMP-dependent protein kinase catalytic subunit alpha (PRKACA)	PF00069	22.656 (58/256)	8.61E-10
ERK activator kinase 7 (MAP2K7)	PF00069	27.311 (65/238)	9.00E-10
Calcium/calmodulin-dependent protein kinase type II subunit beta (CAMK2B)	PF08332 ; PF00069	24.906 (66/265)	9.39E-10
Ribosomal protein S6 kinase alpha-5 (RSK5)	PF00069 ; PF00433	23.345 (67/287)	9.60E-10
MAP kinase p38 (MAPK12)	PF00069	27.602 (61/221)	9.74E-10
Teneurin-2 (TENM2)	PF06484 ; PF15636	33.766 (52/154)	1.04E-09
Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3)	PF00069	25.263 (72/285)	1.20E-09
Mitogen-activated protein kinase 13 (MAPK13)	PF00069	26.636 (57/214)	1.25E-09
CaM-kinase IV kinase (CAMKK1)	PF00069	30.000 (57/190)	1.81E-09
Activin receptor type IIA (ACVR2A)	PF01064 ; PF00069	27.391 (63/230)	1.82E-09
Calcium/calmodulin-dependent protein kinase type 1B (PNCK)	PF00069	25.461 (69/271)	1.88E-09
Dual specificity mitogen-activated protein kinase kinase 6 (MAP2K6)	PF00069	23.723 (65/274)	1.89E-09
Serine/threonine-protein kinase 32A (STK32A)	PF00069	26.809 (63/235)	1.92E-09
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A)	PF08332 ; PF00069	26.496 (62/234)	2.02E-09
Doublecortin-like kinase 2 (DCLK2)	PF03607 ; PF00069	25.098 (64/255)	2.06E-09
Rho-associated protein kinase 1 (ROCK1)	PF00069 ; PF08912	26.141 (63/241)	2.30E-09
Serine/threonine-protein kinase 32C (STK32C)	PF00069	25.098 (64/255)	2.46E-09
Protein kinase C zeta (PRKCZ)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	23.810 (55/231)	2.53E-09
Phosphorylase kinase testis gamma 2 (PHKG2)	PF00069	24.017 (55/229)	3.49E-09
Wnt inhibitory factor 1 (WIF1)	PF12661 ; PF02019	32.903 (51/155)	3.81E-09
Calcium/calmodulin-dependent protein kinase type II subunit delta (CAMK2D)	PF08332 ; PF00069	27.119 (64/236)	4.20E-09
Ribosomal protein S6 kinase alpha-4 (RPS6KA4)	PF00069 ; PF00433	26.421 (79/299)	4.80E-09
Maternal embryonic leucine zipper kinase (MELK)	PF02149 ; PF00069	26.383 (62/235)	4.87E-09
CDC42 binding protein kinase alpha (DMPK-like alpha)	PF00130 ; PF00780 ; PF08826 ; PF15796 ; PF00069 ; PF00433 More >>	23.988 (77/321)	4.87E-09
Stress-activated protein kinase 2b (p38 beta)	PF00069	26.699 (55/206)	5.58E-09
Doublecortin-like kinase 3 (DCLK3)	PF00069	25.926 (56/216)	5.81E-09
Serine/threonine-protein kinase pim-2 (PIM2)	PF00069	21.918 (64/292)	5.92E-09
Serine/threonine-protein kinase NLK (NLK)	PF00069	28.638 (61/213)	6.61E-09
Stress-activated protein kinase 2a (p38 alpha)	PF00069	26.168 (56/214)	7.14E-09
Apoptosis signal-regulating kinase 2 (MAP3K6)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	25.490 (65/255)	7.26E-09
Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform (PHKG1)	PF00069	25.989 (46/177)	7.35E-09
Serine/threonine-protein kinase TAO2 (TAOK2)	PF00069	24.915 (73/293)	8.81E-09
MAPK/ERK kinase kinase 1 (MAP3K1)	PF00069	27.315 (59/216)	8.89E-09
PKC-delta-interacting protein kinase (RIPK4)	PF12796 ; PF00069	25.090 (70/279)	8.92E-09
Yet another novel kinase 2 (STK32B)	PF00069	26.471 (63/238)	9.78E-09
Testis-specific serine/threonine-protein kinase 4 (TSSK4)	PF00069	26.250 (42/160)	1.06E-08
SNF-related serine/threonine-protein kinase (SNRK)	PF00069	24.771 (54/218)	1.35E-08
MEK kinase kinase 2 (MAP4K2)	PF00780 ; PF00069	26.415 (56/212)	1.36E-08
Testis-specific serine/threonine-protein kinase 6 (TSSK6)	PF00069	25.940 (69/266)	1.43E-08
Protein kinase D (PRKD1)	PF00130 ; PF00169 ; PF00069 More >>	27.189 (59/217)	1.52E-08
Serine/threonine-protein kinase MRCK gamma (CDC42BPG)	PF00130 ; PF00780 ; PF08826 ; PF00069 More >>	25.926 (63/243)	1.83E-08
Microtubule-associated serine/threonine-protein kinase 3 (MAST3)	PF08926 ; PF17820 ; PF02163 ; PF00069 More >>	22.695 (64/282)	2.01E-08
PAS domain-containing serine/threonine-protein kinase (PASK)	PF13426 ; PF00069	25.561 (57/223)	2.27E-08
Serine/threonine-protein kinase MRCK beta (CDC42BPB)	PF00130 ; PF00780 ; PF08826 ; PF15796 ; PF00069 More >>	23.256 (80/344)	2.61E-08
Serine/threonine-protein kinase D3 (PRKD3)	PF00130 ; PF00169 ; PF00069 More >>	26.818 (59/220)	2.67E-08
Serine/threonine-protein kinase STK11 (STK11)	PF00069	23.443 (64/273)	2.78E-08
Serine/threonine-protein kinase ICK (CILK1)	PF00069	27.273 (57/209)	2.96E-08
Rho-associated protein kinase 2 (ROCK2)	PF00069 ; PF08912	25.514 (62/243)	3.08E-08
Apoptosis signal-regulating kinase 1 (MAP3K5)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	24.535 (66/269)	3.46E-08
Teneurin-3 (TENM3)	PF06484 ; PF15636	30.323 (47/155)	3.87E-08
Mitogen-activated protein kinase kinase kinase kinase 5 (MAP4K5)	PF00780 ; PF00069	24.424 (53/217)	3.94E-08
Cyclin-dependent kinase 18 (CDK18)	PF00069	24.554 (55/224)	5.49E-08
Serine/threonine-protein kinase Chk2 (RAD53)	PF00498 ; PF00069	29.362 (69/235)	5.61E-08
Calcium/calmodulin-dependent protein kinase type IV (CAMK4)	PF00069	29.493 (64/217)	5.67E-08
Serine/threonine-protein kinase MAK (MAK)	PF00069	25.962 (54/208)	6.28E-08
Bone morphogenetic protein receptor (BMPR2)	PF01064 ; PF00069	24.038 (75/312)	6.95E-08
Cyclin-dependent kinase 10 (CDK10)	PF00069	28.837 (62/215)	7.46E-08
Protein kinase G2 (PRKG2)	PF00027 ; PF00069	23.256 (60/258)	7.60E-08
Dual-specificity tyrosine-phosphorylation regulated kinase 2 (DYRK2)	PF00069	25.000 (54/216)	8.37E-08
Extracellular signal-regulated kinase 1 (ERK1)	PF00069	24.880 (52/209)	8.76E-08
Cyclin-dependent kinase 17 (CDK17)	PF12330 ; PF00069	25.943 (55/212)	1.11E-07
Doublecortin-like kinase 1 (DCLK1)	PF03607 ; PF00069	24.074 (52/216)	1.27E-07
Cyclin-dependent kinase 16 (CDK16)	PF12330 ; PF00069	25.110 (57/227)	1.49E-07
Extracellular signal-regulated kinase 2 (ERK2)	PF00069	27.014 (57/211)	1.51E-07
Cyclin-dependent kinase-like 5 (CDKL5)	PF00069	26.699 (55/206)	1.53E-07
Cyclin-dependent kinase-like 1 (CDKL1)	PF00069	26.415 (56/212)	1.58E-07
Interleukin-1 receptor-associated kinase-like 2 (IRAK2)	PF00531 ; PF00069	23.950 (57/238)	1.70E-07
Slit homolog 2 protein (SLIT2)	PF00008 ; PF12661 ; PF00054 ; PF13855 ; PF01463 ; PF01462 More >>	32.680 (50/153)	1.95E-07
Mucin-3A (MUC3A)		47.273 (26/55)	2.07E-07
MAPK/ERK kinase kinase 2 (MAP3K2)	PF00564 ; PF00069	24.528 (52/212)	2.34E-07
Citron Rho-interacting kinase (CIT)	PF00780 ; PF00169 ; PF00069 More >>	23.237 (56/241)	2.38E-07
Delta-like protein 4 (DLL4)	PF01414 ; PF00008 ; PF07657 More >>	36.054 (53/147)	2.43E-07
MAPK/ERK kinase kinase 4 (MAP3K4)	PF19431 ; PF00069	24.000 (66/275)	2.47E-07
Cyclin-dependent kinase 4 (CDK4)	PF00069	28.655 (49/171)	2.54E-07
G protein-coupled receptor kinase 5 (GRK5)	PF00069 ; PF00615	25.339 (56/221)	2.54E-07
Cyclin-dependent kinase 5 (CDK5)	PF00069	22.381 (47/210)	2.77E-07
Glycogen synthase kinase-3 beta (GSK-3B)	PF00069	27.434 (62/226)	3.10E-07
NDR2 protein kinase (STK38L)	PF00069 ; PF00433	23.396 (62/265)	4.32E-07
Cyclin-dependent kinase 14 (CDK14)	PF00069	26.009 (58/223)	4.47E-07
Mucin-3B (MUC3B)	PF01390	47.273 (26/55)	4.87E-07
Activin receptor type IIB (ACVR2B)	PF01064 ; PF00069	23.207 (55/237)	5.39E-07
Microtubule-associated serine/threonine-protein kinase 4 (MAST4)	PF08926 ; PF17820 ; PF02163 ; PF00069 More >>	21.724 (63/290)	5.93E-07
Stress-activated protein kinase JNK2 (JNK2)	PF00069	27.619 (58/210)	6.15E-07
Cyclin-dependent kinase 11A (CDK11A)	PF00069	26.636 (57/214)	6.18E-07
Cyclin-dependent kinase 15 (CDK15)	PF00069	24.020 (49/204)	6.58E-07
Inhibitor of nuclear factor kappa-B kinase subunit epsilon (IKBKE)	PF00069 ; PF18394 ; PF18396 More >>	28.017 (65/232)	7.20E-07
Microtubule-associated serine/threonine-protein kinase 2 (MAST2)	PF08926 ; PF17820 ; PF00069 More >>	20.968 (52/248)	7.33E-07
Checkpoint kinase-1 (CHK1)	PF00069	25.352 (54/213)	7.86E-07
Stress-activated protein kinase JNK1 (JNK1)	PF00069	27.604 (53/192)	7.96E-07
Glycogen synthase kinase-3 alpha (GSK-3A)	PF00069	26.872 (61/227)	8.09E-07
Stress-activated protein kinase JNK3 (JNK3)	PF00069	27.604 (53/192)	8.26E-07
Myotonin-protein kinase (DMPK)	PF08826 ; PF00069	24.280 (59/243)	9.90E-07
Serine/threonine-protein kinase D2 (PRKD2)	PF00130 ; PF00069	26.267 (57/217)	1.00E-06
Teneurin-1 (TENM1)	PF06484 ; PF15636	35.294 (48/136)	1.06E-06
Adaptor-associated kinase 1 (AAK1)	PF00069	21.927 (66/301)	1.08E-06
TGF-beta-stimulated factor 1 (STK16)	PF00069	22.881 (54/236)	1.11E-06
NDR1 protein kinase (STK38)	PF00069 ; PF00433	22.344 (61/273)	1.20E-06
Serine/threonine-protein kinase NIK (MAP3K14)	PF00069	22.917 (88/384)	1.24E-06
CaM kinase-like vesicle-associated protein (CAMKV)	PF00069	24.885 (54/217)	1.25E-06
Cyclin-dependent kinase 20 (CDK20)	PF00069	25.455 (56/220)	1.42E-06
G protein-coupled receptor kinase 6 (GRK6)	PF00069 ; PF00615	24.074 (52/216)	1.48E-06
Serine/threonine-protein kinase PDIK1L (PDIK1L)	PF00069	20.552 (67/326)	1.50E-06
MAP kinase signal-integrating kinase 2 (MKNK2)	PF00069	25.417 (61/240)	1.81E-06
Ribosomal protein S6 kinase-related protein (RSKR)	PF00069	35.106 (33/94)	1.89E-06
Mitogen-activated protein kinase 4 (MAPK4)	PF00069	26.733 (54/202)	2.01E-06
Striated muscle preferentially expressed protein kinase (SPEG)	PF07679 ; PF00069 ; PF16650 More >>	27.273 (63/231)	2.05E-06
Titin (TTN)		21.514 (54/251)	2.15E-06
Cyclin-dependent kinase 11B (CDK11B)	PF00069	26.636 (57/214)	2.27E-06
Laminin subunit alpha-1 (LAMA1)	PF00052 ; PF00053 ; PF00054 ; PF06008 ; PF06009 ; PF00055 More >>	32.432 (48/148)	2.43E-06
PIM-3 protein kinase (PIM3)	PF00069	28.261 (78/276)	2.84E-06
Dual-specificity tyrosine-phosphorylation regulated kinase 1B (DYRK1B)	PF00069	26.906 (60/223)	3.03E-06
Microtubule-associated serine/threonine-protein kinase 1 (MAST1)	PF08926 ; PF17820 ; PF00069 More >>	21.545 (53/246)	3.24E-06
Stabilin-1 (STAB1)	PF12947 ; PF02469 ; PF00193 More >>	35.714 (45/126)	3.45E-06
IL-1 receptor-associated kinase 3 (IRAK3)	PF00531 ; PF00069	23.188 (64/276)	3.53E-06
Endoplasmic reticulum to nucleus signaling 1 (ERN1)	PF00069 ; PF06479	23.894 (54/226)	4.79E-06
TAO kinase 1 (TAOK1)	PF00069	27.236 (67/246)	6.00E-06
Notch-1 receptor (NOTCH1)	PF12796 ; PF00008 ; PF07645 ; PF12661 ; PF06816 ; PF07684 ; PF00066 More >>	34.921 (44/126)	6.65E-06
NF-kappa-B-activating kinase (TBK1)	PF00069 ; PF18394 ; PF18396 More >>	25.641 (60/234)	6.76E-06
Teneurin-4 (TENM4)	PF07974 ; PF06484 ; PF15636 More >>	35.789 (34/95)	8.41E-06
G protein-coupled receptor kinase 4 (GRK4)	PF00069 ; PF00615	29.897 (29/97)	1.05E-05
Notch-2 receptor (NOTCH2)	PF12796 ; PF00008 ; PF07645 ; PF12661 ; PF06816 ; PF07684 ; PF00066 More >>	32.787 (40/122)	1.06E-05
Serine/threonine-protein kinase 35 (STK35)	PF00069	24.590 (60/244)	1.15E-05
Wee1-like protein kinase (WEE1)	PF00069	21.922 (73/333)	1.16E-05
MAPK signal-integrating kinase 1 (MKNK1)	PF00069	24.232 (71/293)	1.24E-05
Triple functional domain protein (TRIO)	PF00650 ; PF07679 ; PF00169 ; PF00069 ; PF00621 ; PF16609 ; PF00018 ; PF00435 More >>	24.775 (55/222)	1.42E-05
Protein eyes shut homolog (EYS)	PF00008 ; PF12661 ; PF00054 ; PF02210 More >>	28.125 (45/160)	1.54E-05
Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1)	PF00008 ; PF07645 ; PF07699 ; PF12661 ; PF02494 ; PF00354 ; PF00084 ; PF00092 More >>	29.801 (45/151)	1.58E-05
Notch-3 receptor (NOTCH3)	PF12796 ; PF13857 ; PF00008 ; PF07645 ; PF12661 ; PF06816 ; PF07684 ; PF00066 More >>	32.051 (50/156)	1.88E-05
Protein jagged-1 (JAG1)	PF01414 ; PF00008 ; PF07645 ; PF12661 ; PF07657 More >>	33.803 (48/142)	2.08E-05
Dual-specificity tyrosine-phosphorylation regulated kinase 1A (DYRK1A)	PF00069	26.432 (60/227)	2.18E-05
Laminin subunit alpha-3 (LAMA3)	PF00052 ; PF00053 ; PF02210 ; PF06008 ; PF06009 ; PF00055 More >>	32.667 (49/150)	3.39E-05
Homeodomain-interacting protein kinase 4 (HIPK4)	PF00069	23.288 (51/219)	3.60E-05
Laminin subunit alpha-2 (LAMA2)	PF00052 ; PF00053 ; PF00054 ; PF06008 ; PF06009 ; PF00055 More >>	30.709 (39/127)	3.70E-05
Anti-mullerian hormone II receptor (AMHR2)	PF00069	21.654 (55/254)	3.71E-05
Protocadherin Fat 1 (FAT1)	PF00028 ; PF00008 ; PF02210 More >>	29.134 (37/127)	4.01E-05
Serine/threonine-protein kinase greatwall (MASTL)	PF00069	24.405 (41/168)	4.64E-05
MAPK-activated protein kinase 3 (MAPKAPK3)	PF00069	22.603 (66/292)	4.93E-05
Slit homolog 1 protein (SLIT1)	PF00008 ; PF12661 ; PF02210 ; PF13855 ; PF01463 ; PF01462 More >>	28.750 (46/160)	5.11E-05
Serine/threonine-protein kinase pim-1 (PIM1)	PF00069	24.176 (66/273)	5.21E-05
Sugen kinase 110 (SBK3)	PF00069	26.994 (44/163)	6.60E-05
Cyclin-dependent kinase-like 4 (CDKL4)	PF00069	22.381 (47/210)	6.93E-05
TAO kinase 3 (TAOK3)	PF00069	25.714 (72/280)	7.83E-05
Laminin subunit beta-2 (LAMB2)	PF00053 ; PF00055	34.783 (48/138)	7.95E-05
Mitogen-activated protein kinase 6 (MAPK6)	PF00069	25.701 (55/214)	8.73E-05
PRKR-like endoplasmic reticulum kinase (PERK)	PF00069	24.540 (40/163)	8.86E-05
Cyclin-G-associated kinase (GAK)	PF00069 ; PF10409	23.826 (71/298)	9.83E-05
Notch-4 receptor (NOTCH4)	PF12796 ; PF13637 ; PF00008 ; PF07645 ; PF12661 ; PF06816 ; PF07684 ; PF00066 More >>	35.065 (54/154)	9.84E-05
Serine/threonine-protein kinase SBK2 (SBK2)	PF00069	24.889 (56/225)	1.16E-04
Slit homolog 3 protein (SLIT3)	PF00008 ; PF12661 ; PF02210 ; PF13855 ; PF01463 ; PF01462 More >>	29.221 (45/154)	1.28E-04
Tau-tubulin kinase (TTBK1)	PF00069	24.268 (58/239)	1.38E-04
Jagged-2 protein (JAG2)	PF01414 ; PF00008 ; PF07645 ; PF12661 ; PF07657 More >>	37.324 (53/142)	1.55E-04
Serine/threonine kinase-like domain-containing protein STKLD1 (STKLD1)	PF00069	28.421 (27/95)	1.58E-04
Vitamin K-dependent protein Z (PROZ)	PF00008 ; PF14670 ; PF00594 ; PF00089 More >>	36.585 (30/82)	1.62E-04
Hedgehog-interacting protein (HHIP)	PF03024 ; PF07995	33.333 (27/81)	1.69E-04
TBC domain-containing protein kinase-like protein (TBCK)	PF00069 ; PF00566 ; PF00581 More >>	26.496 (31/117)	1.86E-04
Homeodomain-interacting protein kinase 3 (HIPK3)	PF00069	24.091 (53/220)	1.93E-04
Delta-like protein 1 (DLL1)	PF01414 ; PF00008 ; PF12661 ; PF07657 More >>	34.591 (55/159)	2.06E-04
Protein delta homolog 1 (DLK1)	PF00008	34.532 (48/139)	2.11E-04
N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA)	PF09992	33.000 (33/100)	2.55E-04
Eukaryotic translation initiation factor 2-alpha kinase 4 (EIF2AK4)	PF12745 ; PF00069 ; PF05773 ; PF13393 More >>	23.077 (36/156)	3.04E-04
Eukaryotic translation initiation factor 2-alpha kinase 1 (EIF2AK1)	PF00069	28.440 (31/109)	3.12E-04
Rhodopsin kinase GRK1 (GRK1)	PF00069 ; PF00615	22.967 (48/209)	3.23E-04
Netrin-G1 (NTNG1)	PF00053 ; PF00055	42.188 (27/64)	4.82E-04
MAPK-activated protein kinase 2 (MAPKAPK2)	PF00069	23.420 (63/269)	4.86E-04
Versican core protein (VCAN)	PF00008 ; PF00059 ; PF00084 ; PF07686 ; PF00193 More >>	29.008 (38/131)	5.29E-04
Serine/threonine-protein kinase ULK4 (ULK4)	PF00069	24.615 (48/195)	5.36E-04
Cadherin EGF LAG seven-pass G-type receptor 1 (CELSR1)	PF00002 ; PF00028 ; PF00008 ; PF16489 ; PF01825 ; PF02793 ; PF00053 ; PF02210 More >>	23.757 (43/181)	5.62E-04
Cadherin EGF LAG seven-pass G-type receptor 3 (CELSR3)	PF00002 ; PF00028 ; PF00008 ; PF16489 ; PF01825 ; PF00053 ; PF02210 More >>	31.967 (39/122)	6.30E-04
Tau-tubulin kinase 2 (TTBK2)	PF00069	22.689 (54/238)	7.05E-04
Large tumor suppressor homolog 2 (LATS2)	PF00069 ; PF00433	25.309 (41/162)	7.26E-04
Protocadherin Fat 2 (FAT2)	PF00028 ; PF00008 ; PF02210 More >>	33.333 (34/102)	8.01E-04
Hemicentin-1 (HMCN1)	PF12662 ; PF07645 ; PF07474 ; PF07679 ; PF13927 ; PF00090 More >>	25.000 (28/112)	1.00E-03
Protein crumbs homolog 1 (CRB1)	PF00008 ; PF12661 ; PF02210 More >>	31.148 (38/122)	1.00E-03
Tribbles homolog 2 (TRIB2)	PF00069	24.272 (50/206)	1.00E-03
Protein delta homolog 2 (DLK2)	PF00008 ; PF12661	35.455 (39/110)	1.00E-03
Serine/threonine-protein kinase Kist (UHMK1)	PF00069 ; PF00076	25.714 (45/175)	1.00E-03
Serine/threonine-protein kinase LATS1 (LATS1)	PF00069 ; PF00627	21.245 (58/273)	1.00E-03
Serine/threonine-protein kinase tousled-like 2 (TLK2)	PF00069	23.318 (52/223)	2.00E-03
Delta and Notch-like epidermal growth factor-related receptor (DNER)	PF19330 ; PF00008 ; PF12661 More >>	27.007 (37/137)	2.00E-03
Wee1-like protein kinase 2 (WEE2)	PF00069	18.612 (59/317)	2.00E-03
Rhodopsin kinase GRK7 (GRK7)	PF00069 ; PF00615	23.970 (64/267)	2.00E-03
Click to Show/Hide the Information of Human Similarity Proteins


Note: If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.

Degree	1	Degree centrality	1.07E-04	Betweenness centrality	0.00E+00
Closeness centrality	1.73E-01	Radiality	1.28E+01	Clustering coefficient	0.00E+00
Neighborhood connectivity	4.00E+00	Topological coefficient	1.00E+00	Eccentricity	13
Download	Click to Download the Full PPI Network of This Target

Chemical Structure based Activity Landscape of Target

Top

References

Top

REF 1

Improvement in oral bioavailability of 2,4-diaminopyrimidine c-Met inhibitors by incorporation of a 3-amidobenzazepin-2-one group. Bioorg Med Chem. 2011 Nov 1;19(21):6274-84.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN