Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T97752
(Former ID: TTDI02246)
|
|||||
| Target Name |
Ebola virus VP24 messenger RNA (EV VP24 mRNA)
|
|||||
| Synonyms |
rVP24 (mRNA); VP24 (mRNA); Reston VP24 (mRNA); Membrane-associated protein VP24 (mRNA)
Click to Show/Hide
|
|||||
| Gene Name |
EV VP24 mRNA
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Filovirus disease [ICD-11: 1D60] | |||||
| Function |
Blocks the IFN-induced nuclear accumulation of host phosphorylated STAT1, by interacting with the STAT1-binding region of host importin alpha-1/KPNA1 protein, thereby inhibiting the latter. Without the activity of this protein, activated STAT1 would not enter the nucleus and be unable to activate IFN-induced genes. Plays a role in assembly of viral nucleocapsid and virion budding. May act as a minor matrix protein that plays a role in assembly of viral nucleocapsid and virion budding. Prevents the establishment of cellular antiviral state by blocking the interferon-alpha/beta (IFN-alpha/beta) and IFN-gamma signaling pathways.
Click to Show/Hide
|
|||||
| BioChemical Class |
mRNA target
|
|||||
| UniProt ID | ||||||
| Sequence |
MAKATGRYNLVTPKRELEQGVVFSDLCNFLVTPTVQGWKVYWAGLEFDVNQKGITLLNRL
KVNDFAPAWAMTRNLFPHLFKNQQSEVQTPIWALRVILAAGILDQLMDHSLIEPLSGALN LIADWLLTTSTNHFNMRTQRVKDQLSMRMLSLIRSNIINFINKLETLHVVNYKGLLSSVE IGTPSYAIIITRTNMGYLVEVQEPDKSAMDIRHPGPVKFSLLHESTLKPVATPKPSSITS LIMEFNSSLAI Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 3 Clinical Trial Drugs | + | ||||
| 1 | AVI-6002 | Drug Info | Phase 1 | Ebola virus infection | [2] | |
| 2 | AVI-6003 | Drug Info | Phase 1 | Marburg virus infection | [3] | |
| 3 | AVI-7537 | Drug Info | Phase 1 | Ebola virus infection | [4] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 2 Modulator drugs | + | ||||
| 1 | AVI-6002 | Drug Info | [1] | |||
| 2 | AVI-6003 | Drug Info | [1] | |||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Discovery and Early Development of AVI-7537 and AVI-7288 for the Treatment of Ebola Virus and Marburg Virus Infections. Viruses. 2012 November; 4(11): 2806-2830. | |||||
| REF 2 | ClinicalTrials.gov (NCT01353027) Safety Study of Single Administration Post-Exposure Prophylaxis Treatment for Ebola Virus. U.S. National Institutes of Health. | |||||
| REF 3 | ClinicalTrials.gov (NCT01353040) Safety Study of Single Administration Post-exposure Prophylaxis Treatment for Marburg Virus. U.S. National Institutes of Health. | |||||
| REF 4 | ClinicalTrials.gov (NCT01593072) A Study to Assess the Safety, Tolerability and Pharmacokinetics of AVI-7537 in Healthy Adult Volunteers. U.S. National Institutes of Health. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.