Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T96179
|
|||||
| Target Name |
Integral membrane protein GPR137 (GPR137)
|
|||||
| Synonyms |
Transmembrane 7 superfamily member 1-like 1 protein; TM7SF1L1; GPR137A; C11orf4
Click to Show/Hide
|
|||||
| Gene Name |
GPR137
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Function |
It is a peptide which displays four putative transmembrane domains and is predicted to have a cytoplasmic localization. The receptor is available in the following formats: stable over-expression cell line, membrane preparation, or purified receptor in HEK293 or CHO.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MESNLSGLVPAAGLVPALPPAVTLGLTAAYTTLYALLFFSVYAQLWLVLLYGHKRLSYQT
VFLALCLLWAALRTTLFSFYFRDTPRANRLGPLPFWLLYCCPVCLQFFTLTLMNLYFAQV VFKAKVKRRPEMSRGLLAVRGAFVGASLLFLLVNVLCAVLSHRRRAQPWALLLVRVLVSD SLFVICALSLAACLCLVARRAPSTSIYLEAKGTSVCQAAAMGGAMVLLYASRACYNLTAL ALAPQSRLDTFDYDWYNVSDQADLVNDLGNKGYLVFGLILFVWELLPTTLLVGFFRVHRP PQDLSTSHILNGQVFASRSYFFDRAGHCEDEGCSWEHSRGESTRCQDQAATTTVSTPPHR RDPPPSPTEYPGPSPPHPRPLCQVCLPLLAQDPGGRGYPLLWPAPCCSCHSELVPSP Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| HIT2.0 ID | T91J2T | |||||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Down-regulation of GPR137 expression inhibits proliferation of colon cancer cells. RETRACTED ARTICLESee: Retraction NoticeActa Biochim Biophys Sin (Shanghai). 2014 Nov;46(11):935-41. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.