Target Information

Target General Information

Target ID

T93263

Target Name

Endophilin-A2 (SH3GL1)

Synonyms

SH3D2B; SH3 domain-containing GRB2-like protein 1; SH3 domain protein 2B; Extra eleven-nineteen leukemia fusion gene protein; Endophilin-2; EEN fusion partner of MLL; EEN; CNSA1

Click to Show/Hide

Gene Name

SH3GL1

Target Type

Literature-reported target

[1]

Function

Implicated in endocytosis. May recruit other proteins to membranes with high curvature.

Click to Show/Hide

BioChemical Class

Endophilin family

UniProt ID

SH3G1_HUMAN

Sequence

MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQP
NPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES
MKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKL
KRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPS
RSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYV
EVLVPLPQ

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

HIT2.0 ID

T91RI2

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues. The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021). Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function. Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006). Human Similarity Proteins Human Tissue Distribution Human Pathway Affiliation

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.

The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021).

Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.

Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006).

Human Similarity Proteins

Human Tissue Distribution

Human Pathway Affiliation

Protein Name	Pfam ID	Percentage of Identity (%)	E value
SH3 domain-containing kinase-binding protein 1 (SH3KBP1)	PF14604	45.614 (26/57)	6.52E-11
Nostrin (NOSTRIN)	PF00611 ; PF14604	25.862 (45/174)	7.38E-10
Abl interactor 2 (ABI2)	PF07815 ; PF14604	40.385 (21/52)	1.11E-08
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1)	PF12796 ; PF01412 ; PF16746 ; PF00169 ; PF14604 More >>	43.636 (24/55)	1.51E-08
Rho guanine nucleotide exchange factor 7 (ARHGEF7)	PF00307 ; PF00169 ; PF00621 ; PF16615 ; PF16614 ; PF07653 More >>	40.741 (22/54)	6.11E-08
Rho guanine nucleotide exchange factor 6 (ARHGEF6)	PF16523 ; PF00307 ; PF00169 ; PF00621 ; PF16615 ; PF16614 ; PF07653 More >>	32.927 (27/82)	9.31E-08
Src substrate cortactin (CTTN)	PF02218 ; PF14604	42.000 (21/50)	1.69E-07
SH3 and cysteine-rich domain-containing protein (STAC)	PF00130 ; PF07653 ; PF14604 ; PF16664 More >>	37.500 (24/64)	3.94E-07
ABI gene family member 3 (ABI3)	PF07815 ; PF14604	43.750 (21/48)	8.33E-07
Drebrin-like protein (DBNL)	PF00241 ; PF14604	40.741 (22/54)	1.42E-06
SH3 and cysteine-rich domain-containing protein 2 (STAC2)	PF00130 ; PF14604 ; PF16664 More >>	35.849 (19/53)	1.44E-06
Nebulin (NEB)	PF00880 ; PF14604	32.692 (34/104)	1.51E-06
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2)	PF12796 ; PF01412 ; PF16746 ; PF00169 ; PF14604 More >>	30.973 (35/113)	1.57E-06
Growth arrest-specific protein 7 (GAS7)	PF00611 ; PF14604 ; PF00397 ; PF16623 More >>	45.455 (25/55)	2.21E-06
Sorting nexin-18 (SNX18)	PF10456 ; PF00787 ; PF14604 More >>	46.296 (25/54)	2.59E-06
LIM and SH3 domain protein 1 (LASP1)	PF00412 ; PF00880 ; PF14604 More >>	33.846 (22/65)	2.85E-06
SH3 domain-containing protein 21 (SH3D21)	PF07653	35.294 (18/51)	8.45E-06
Mixed lineage kinase 3 (MAP3K11)	PF07714 ; PF14604	36.842 (21/57)	1.11E-05
Nebulette (NEBL)	PF00880 ; PF14604	30.357 (17/56)	2.68E-05
Rho guanine nucleotide exchange factor 5 (ARHGEF5)	PF15441 ; PF00621 ; PF14604 More >>	32.203 (19/59)	2.89E-05
Proline-serine-threonine phosphatase-interacting protein 1 (PSTPIP1)	PF00611 ; PF14604	36.538 (19/52)	4.29E-05
Guanine nucleotide exchange factor VAV2 (VAV2)	PF00130 ; PF11971 ; PF00169 ; PF00621 ; PF00017 ; PF07653 More >>	39.216 (20/51)	4.32E-05
RIMS-binding protein 2 (RIMBP2)	PF07653 ; PF14604	40.351 (23/57)	6.02E-05
Protein kinase C and casein kinase substrate in neurons protein 1 (PACSIN1)	PF00611 ; PF14604	30.556 (33/108)	6.50E-05
Cas scaffolding protein family member 4 (CASS4)	PF12026 ; PF08824 ; PF14604 More >>	33.929 (19/56)	8.85E-05
Rho GTPase-activating protein 26 (ARHGAP26)	PF16746 ; PF00169 ; PF00620 ; PF14604 More >>	43.396 (23/53)	9.08E-05
Guanine nucleotide exchange factor VAV3 (VAV3)	PF00130 ; PF11971 ; PF00169 ; PF00621 ; PF00017 ; PF07653 More >>	38.000 (19/50)	1.84E-04
Enhancer of filamentation 1 (NEDD9)	PF12026 ; PF08824 ; PF14604 More >>	37.500 (21/56)	5.98E-04
Peripheral-type benzodiazepine receptor-associated protein 1 (TSPOAP1)	PF07653 ; PF14604	27.660 (26/94)	1.00E-03
Mixed lineage kinase 4 (MAP3K21)	PF07714 ; PF14604	33.962 (18/53)	1.00E-03
Mixed lineage kinase 2 (MAP3K10)	PF07714 ; PF14604	36.207 (21/58)	2.00E-03
Sorting nexin-33 (SNX33)	PF10456 ; PF00787 ; PF14604 More >>	35.185 (19/54)	2.00E-03
Rho GTPase-activating protein 10 (ARHGAP10)	PF16746 ; PF00169 ; PF00620 ; PF14604 More >>	28.421 (27/95)	4.00E-03
Mixed lineage kinase 1 (MAP3K9)	PF00069 ; PF14604	33.333 (19/57)	5.00E-03
Click to Show/Hide the Information of Human Similarity Proteins


Note: If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.

KEGG Pathway	Pathway ID	Affiliated Target	Pathway Map
Endocytosis	hsa04144	Affiliated Target
Class: Cellular Processes => Transport and catabolism	Pathway Hierarchy

Target Affiliated Biological Pathways

Top

KEGG Pathway

[+] 1 KEGG Pathways

Endocytosis

References

Top

REF 1

Endophilin A2 Promotes TNBC Cell Invasion and Tumor Metastasis. Mol Cancer Res. 2015 Jun;13(6):1044-55.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN