Target Information

Target General Information

Top

Target ID

T92902

Target Name

Tripartite motif-containing 59 (TRIM59)

Synonyms

Tumor suppressor TSBF-1; TSBF1; TRIM57; RNF104; RING finger protein 104

Click to Show/Hide

Gene Name

TRIM59

Target Type

Literature-reported target

[1]

Function

May serve as a multifunctional regulator for innate immune signaling pathways.

Click to Show/Hide

BioChemical Class

TRIM/RBCC family

UniProt ID

TRI59_HUMAN

Sequence

MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCR
SITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLLDKKLVCGHC
LTIGQHHGHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQG
DKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTI
SLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV
LIPKMKISPKRMSCSWPGKDEKEVEFLKILNIVVVTLISVILMSILFFNQHIITFLSEIT
LIWFSEASLSVYQSLSNSLHKVKNILCHIFYLLKEFVWKIVSH

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Similarity Proteins

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Similarity Proteins

Protein Name	Pfam ID	Percentage of Identity (%)	E value
E3 ubiquitin-protein ligase TRIM69 (TRIM69)	PF13765 ; PF00622 ; PF15227 More >>	26.502 (75/283)	5.08E-12
Tripartite motif-containing protein 43B (TRIM43B)	PF00622 ; PF15227	23.200 (58/250)	1.58E-11
Tripartite motif-containing protein 64 (TRIM64)	PF00622 ; PF00097	28.571 (38/133)	1.87E-10
Tripartite motif-containing protein 43 (TRIM43)	PF00622 ; PF15227	28.302 (45/159)	1.98E-10
Tripartite motif-containing protein 64C (TRIM64C)	PF00622	28.105 (43/153)	7.37E-10
Putative tripartite motif-containing protein 64B (TRIM64B)	PF00622 ; PF00097	27.820 (37/133)	1.06E-09
Tripartite motif-containing protein 51 (TRIM51)	PF00622 ; PF15227	24.336 (55/226)	1.15E-09
Putative tripartite motif-containing protein 51G (TRIM51G)	PF00622 ; PF15227	28.358 (38/134)	1.16E-09
E3 ubiquitin-protein ligase TRIM8 (TRIM8)	PF00097	37.349 (31/83)	2.79E-08
E3 ubiquitin-protein ligase SH3RF1 (SH3RF1)	PF00018 ; PF14604 ; PF13923 More >>	34.146 (28/82)	4.36E-07
E3 ubiquitin-protein ligase RNF135 (RNF135)	PF00622 ; PF15227	31.313 (31/99)	1.02E-06
RING finger protein 223 (RNF223)	PF13639	31.522 (29/92)	2.35E-06
Tripartite motif-containing protein 49D (TRIM49D1; TRIM49D2)	PF00622 ; PF15227	26.957 (31/115)	5.90E-06
E3 ubiquitin-protein ligase SH3RF3 (SH3RF3)	PF00018 ; PF14604 ; PF00097 More >>	33.696 (31/92)	6.07E-06
Probable E3 ubiquitin-protein ligase TRIML1 (TRIML1)	PF13765 ; PF00622 ; PF15227 More >>	38.983 (23/59)	6.40E-06
RING finger protein 39 (RNF39)	PF13765 ; PF00097	37.097 (23/62)	2.36E-05
Bifunctional apoptosis regulator (BFAR)	PF00536 ; PF15227	34.177 (27/79)	2.38E-05
Tripartite motif-containing protein 77 (TRIM77)	PF00622 ; PF00097	22.188 (73/329)	2.83E-05
E3 ubiquitin-protein ligase RNF183 (RNF183)	PF13639	32.558 (28/86)	9.00E-05
Roquin-2 (RC3H2)	PF18386 ; PF00642	33.684 (32/95)	9.68E-05
Ankyrin repeat and IBR domain-containing protein 1 (ANKIB1)	PF00023 ; PF19422 ; PF01485 More >>	51.515 (17/33)	7.93E-04
LON peptidase N-terminal domain and RING finger protein 1 (LONRF1)	PF02190 ; PF13923 ; PF15227 More >>	43.750 (14/32)	1.00E-03
V(D)J recombination-activating protein 1 (RAG1)	PF12940 ; PF12560 ; PF13923 ; PF10426 More >>	32.857 (23/70)	1.00E-03
E3 ubiquitin-protein ligase COP1 (RFWD2)	PF00400 ; PF13923	25.610 (21/82)	1.00E-03
E3 ubiquitin-protein ligase PDZRN3 (PDZRN3)	PF00595 ; PF13923	37.500 (12/32)	1.00E-03
Ret finger protein-like 4B (RFPL4B)	PF00622 ; PF15227	27.869 (17/61)	2.00E-03
RING finger protein 225 (RNF225)	PF13639	33.766 (26/77)	2.00E-03
E3 ubiquitin-protein ligase RNF166 (RNF166)	PF13923 ; PF05605 ; PF18574 More >>	37.288 (22/59)	4.00E-03
Ligand of Numb protein X 2 (LNX2)	PF00595 ; PF13923	45.714 (16/35)	4.00E-03
Click to Show/Hide the Information of Human Similarity Proteins

References

Top

REF 1

Tripartite Motif-Containing Protein 59 (TRIM59) Promotes Epithelial Ovarian Cancer Progression via the Focal Adhesion Kinase(FAK)/AKT/Matrix Metall... Med Sci Monit. 2019 May 7;25:3366-3373.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN