Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T92072
(Former ID: TTDS00186)
|
|||||
Target Name |
Adenosine A1 receptor (ADORA1)
|
|||||
Synonyms |
Adenosine receptor A1; A(1) adenosine receptor
|
|||||
Gene Name |
ADORA1
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Orthostatic hypotension [ICD-11: BA21] | |||||
Function |
The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. Receptor for adenosine.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL KIWNDHFRCQPAPPIDEDLPEERPDD Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
ADReCS ID | BADD_A01328 ; BADD_A01334 | |||||
HIT2.0 ID | T35LKG |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
1 | Caffeine | Drug Info | Approved | Orthostatic hypotension | [2], [3] | |
Clinical Trial Drug(s) | [+] 12 Clinical Trial Drugs | + | ||||
1 | Rolofylline | Drug Info | Phase 3 | Heart failure | [4], [5] | |
2 | AMP-579 | Drug Info | Phase 2 | Hyperlipidaemia | [6] | |
3 | Apaxifylline | Drug Info | Phase 2 | Cognitive impairment | [7] | |
4 | BAY 1067197 | Drug Info | Phase 2 | Heart failure | [8] | |
5 | Capadenoson | Drug Info | Phase 2 | Atrial fibrillation | [9] | |
6 | DTI-0009 | Drug Info | Phase 2 | Atrial fibrillation | [10] | |
7 | SELODENOSON | Drug Info | Phase 2 | Cardiac arrhythmias | [10] | |
8 | SLV320 | Drug Info | Phase 2 | Heart failure | [11], [12] | |
9 | Tonapofylline | Drug Info | Phase 2 | Acute and chronic heart failure | [13] | |
10 | INO-8875 | Drug Info | Phase 1/2 | Glaucoma/ocular hypertension | [14] | |
11 | GS 9667 | Drug Info | Phase 1 | Hypertriglyceridemia | [15], [16] | |
12 | KF-17837 | Drug Info | Phase 1 | Parkinson disease | [17] | |
Discontinued Drug(s) | [+] 11 Discontinued Drugs | + | ||||
1 | CVT-124 | Drug Info | Discontinued in Phase 3 | Autoimmune diabetes | [18] | |
2 | N-0861 | Drug Info | Discontinued in Phase 3 | Cardiac disease | [19] | |
3 | Tecadenoson | Drug Info | Discontinued in Phase 3 | Cardiac arrhythmias | [20], [21] | |
4 | BRL-61063 | Drug Info | Discontinued in Phase 2 | Allergy | [22] | |
5 | FK-352 | Drug Info | Discontinued in Phase 2 | Hypertension | [23] | |
6 | FK-453 | Drug Info | Discontinued in Phase 2 | Renal failure | [24], [25] | |
7 | FK-838 | Drug Info | Discontinued in Phase 2 | Hypertension | [26] | |
8 | GW-493838 | Drug Info | Discontinued in Phase 2 | Neuropathic pain | [27] | |
9 | GR-79236 | Drug Info | Discontinued in Phase 1 | Diabetic complication | [28], [29] | |
10 | SDZ-WAG-994 | Drug Info | Discontinued in Phase 1 | Hypertension | [30] | |
11 | METHYLTHIOADENOSINE | Drug Info | Terminated | Multiple sclerosis | [32] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | BAY 60-6583 | Drug Info | Preclinical | Myocardial ischemia | [31] | |
Mode of Action | [+] 4 Modes of Action | + | ||||
Antagonist | [+] 42 Antagonist drugs | + | ||||
1 | Caffeine | Drug Info | [1], [33] | |||
2 | Rolofylline | Drug Info | [5] | |||
3 | Apaxifylline | Drug Info | [35] | |||
4 | SLV320 | Drug Info | [12] | |||
5 | CVT-124 | Drug Info | [48], [49] | |||
6 | N-0861 | Drug Info | [50] | |||
7 | FK-352 | Drug Info | [52] | |||
8 | (E)-8-(3-chlorostyryl)-caffeine | Drug Info | [64] | |||
9 | 4-Ethoxy-7-((E)-styryl)-furo[3,2-g]chromen-5-one | Drug Info | [95] | |||
10 | 8-cyclopentyltheophylline | Drug Info | [100] | |||
11 | AS100 | Drug Info | [106] | |||
12 | AS70 | Drug Info | [106] | |||
13 | AS99 | Drug Info | [106] | |||
14 | ATL802 | Drug Info | [107] | |||
15 | CPFPX | Drug Info | [110] | |||
16 | flavone | Drug Info | [95] | |||
17 | FR194921 | Drug Info | [114] | |||
18 | isobutylmethylxanthine | Drug Info | [120], [121] | |||
19 | KF26777 | Drug Info | [123] | |||
20 | MRE 2029F20 | Drug Info | [128] | |||
21 | MRE 3008F20 | Drug Info | [109] | |||
22 | MRS1041 | Drug Info | [95] | |||
23 | MRS1042 | Drug Info | [95] | |||
24 | MRS1062 | Drug Info | [95] | |||
25 | MRS1065 | Drug Info | [95] | |||
26 | MRS1084 | Drug Info | [95] | |||
27 | MRS1086 | Drug Info | [95] | |||
28 | MRS1093 | Drug Info | [95] | |||
29 | MRS1132 | Drug Info | [95] | |||
30 | MRS1191 | Drug Info | [125] | |||
31 | MRS1523 | Drug Info | [125] | |||
32 | MRS923 | Drug Info | [95] | |||
33 | MRS928 | Drug Info | [95] | |||
34 | PSB-10 | Drug Info | [138] | |||
35 | PSB-11 | Drug Info | [138] | |||
36 | PSB36 | Drug Info | [139] | |||
37 | PSB603 | Drug Info | [137] | |||
38 | sakuranetin | Drug Info | [95] | |||
39 | VUF5574 | Drug Info | [145] | |||
40 | WRC-0571 | Drug Info | [146] | |||
41 | xanthine amine congener | Drug Info | [120] | |||
42 | [3H]DPCPX | Drug Info | [147] | |||
Modulator | [+] 7 Modulator drugs | + | ||||
1 | AMP-579 | Drug Info | [34] | |||
2 | BAY 1067197 | Drug Info | [36] | |||
3 | FK-453 | Drug Info | [53] | |||
4 | FK-838 | Drug Info | [54] | |||
5 | GW-493838 | Drug Info | [37] | |||
6 | L-97-1 intravenous | Drug Info | [125] | |||
7 | Paeoniflorin | Drug Info | [125] | |||
Agonist | [+] 22 Agonist drugs | + | ||||
1 | Capadenoson | Drug Info | [37] | |||
2 | DTI-0009 | Drug Info | [38], [39] | |||
3 | SELODENOSON | Drug Info | [38], [39], [40] | |||
4 | INO-8875 | Drug Info | [43] | |||
5 | GS 9667 | Drug Info | [44] | |||
6 | PMID27387065-Compound-6 | Drug Info | [47] | |||
7 | Tecadenoson | Drug Info | [48], [49] | |||
8 | GR-79236 | Drug Info | [55] | |||
9 | SDZ-WAG-994 | Drug Info | [56] | |||
10 | BAY 60-6583 | Drug Info | [57] | |||
11 | (R,S)-PHPNECA | Drug Info | [65] | |||
12 | (S)-PIA | Drug Info | [66] | |||
13 | 2-chloroadenosine | Drug Info | [88] | |||
14 | 5-Cl-5-deoxy-(+/-)-ENBA | Drug Info | [73] | |||
15 | CP608,039 | Drug Info | [109] | |||
16 | LUF5831 | Drug Info | [127] | |||
17 | MRS5151 | Drug Info | [129] | |||
18 | N(6)-cyclohexyladenosine | Drug Info | [130] | |||
19 | PENECA | Drug Info | [65] | |||
20 | TCPA | Drug Info | [142] | |||
21 | [3H]CCPA | Drug Info | [140], [71] | |||
22 | [3H]HEMADO | Drug Info | [148] | |||
Inhibitor | [+] 239 Inhibitor drugs | + | ||||
1 | Tonapofylline | Drug Info | [41], [42] | |||
2 | KF-17837 | Drug Info | [45] | |||
3 | SCH-442416 | Drug Info | [46] | |||
4 | BRL-61063 | Drug Info | [51] | |||
5 | ARISTEROMYCIN | Drug Info | [58] | |||
6 | METHYLTHIOADENOSINE | Drug Info | [59] | |||
7 | METRIFUDIL | Drug Info | [60] | |||
8 | ZM-241385 | Drug Info | [61] | |||
9 | (1-Phenyl-propyl)-(9-phenyl-9H-purin-6-yl)-amine | Drug Info | [62] | |||
10 | (1H-Imidazo[4,5-c]quinolin-4-yl)-phenyl-amine HCl | Drug Info | [63] | |||
11 | (2-Chloro-9-methyl-9H-purin-6-yl)-phenyl-amine | Drug Info | [62] | |||
12 | (9-Methyl-9H-purin-6-yl)-phenyl-amine | Drug Info | [62] | |||
13 | 1,3-Diallyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
14 | 1,3-Diethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
15 | 1,3-Diisobutyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
16 | 1,3-Dipropyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
17 | 1-Butyl-8-phenyl-3,7-dihydro-purine-2,6-dione | Drug Info | [68] | |||
18 | 1-Methyl-8-phenyl-3,7-dihydro-purine-2,6-dione | Drug Info | [69] | |||
19 | 1-METHYLXANTHINE | Drug Info | [67] | |||
20 | 1-Propyl-3,7-dihydro-purine-2,6-dione | Drug Info | [70] | |||
21 | 1H-Imidazo[4,5-c]quinolin-4-ylamine HCl | Drug Info | [63] | |||
22 | 2'-Me-tecadenoson | Drug Info | [71] | |||
23 | 2,4-Dichloro-N-(4-phenyl-thiazol-2-yl)-benzamide | Drug Info | [72] | |||
24 | 2,5'-dichloro-5'-deoxy-N6-cyclopentyladenosine | Drug Info | [73] | |||
25 | 2,6,8-triphenyl-9H-purine | Drug Info | [74] | |||
26 | 2,6-bis(4-tolyl)-9H-purine | Drug Info | [74] | |||
27 | 2,6-dimethyl-8-ethyl-1-deazapurine | Drug Info | [75] | |||
28 | 2,6-diphenyl-1-deazapurine | Drug Info | [75] | |||
29 | 2,6-diphenyl-8-(1-ethylpropyl)-1-deazapurine | Drug Info | [75] | |||
30 | 2,6-diphenyl-8-ethyl-1-deazapurine | Drug Info | [75] | |||
31 | 2,6-diphenyl-8-methyl-1-deazapurine | Drug Info | [75] | |||
32 | 2,6-diphenyl-8-tButyl-1-deazapurine | Drug Info | [75] | |||
33 | 2,6-diphenyl-9H-purine | Drug Info | [74] | |||
34 | 2,6-Diphenyl-pyrimidin-4-ylamine | Drug Info | [76] | |||
35 | 2,6-dphenyl-8-propyl-1-deazapurine | Drug Info | [75] | |||
36 | 2-(1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [77] | |||
37 | 2-(2''-indolylethyloxy)adenosine | Drug Info | [78] | |||
38 | 2-(2-furyl)-6-(1H-pyrazol-1-yl)pyrimidin-4-amine | Drug Info | [79] | |||
39 | 2-(3''(5''-chloro-indolyl)ethyloxy)adenosine | Drug Info | [78] | |||
40 | 2-(3''(7''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [78] | |||
41 | 2-(3''-(4''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [78] | |||
42 | 2-(3''-(5''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [78] | |||
43 | 2-(3''-(5''-fluoro-indolyl)ethyloxy)adenosine | Drug Info | [78] | |||
44 | 2-(3''-(5''-hydroxyindolyl)ethyloxy)adenosine | Drug Info | [78] | |||
45 | 2-(3''-(5''-iodo-indolyl)ethyloxy)adenosine | Drug Info | [78] | |||
46 | 2-(3''-(5''-methoxy-indolyl)ethyloxy)adenosine | Drug Info | [78] | |||
47 | 2-(3''-(6''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [78] | |||
48 | 2-(3''-(6''-chloro-indolyl)ethyloxy)adenosine | Drug Info | [78] | |||
49 | 2-(3''-indolylethyloxy)adenosine | Drug Info | [78] | |||
50 | 2-(3''-pyrrolylethyloxy)adenosine | Drug Info | [78] | |||
51 | 2-(4-chloro-1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [80] | |||
52 | 2-(4-chlorophenyl)-6-phenyl-9H-purine | Drug Info | [74] | |||
53 | 2-(4-ethylthiobenzimidazol-2-yl)quinoxaline | Drug Info | [80] | |||
54 | 2-(4-hydroxypent-1-yl)-N6-methoxyadenosine | Drug Info | [81] | |||
55 | 2-(4-methoxyphenyl)-6-phenyl-9H-purine | Drug Info | [74] | |||
56 | 2-(4-methyl-1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [77] | |||
57 | 2-(5-cyano-1-pent-1-ynyl)-N6-methoxyadenosine | Drug Info | [81] | |||
58 | 2-(6-amino-8-bromo-9H-purin-9-yl)ethanol | Drug Info | [82] | |||
59 | 2-(6-Cyclopentylamino-purin-9-yl)-ethanol | Drug Info | [62] | |||
60 | 2-(hex-1-ynyl)-N6-methoxyadenosine | Drug Info | [81] | |||
61 | 2-Amino-4,6-di-furan-2-yl-nicotinonitrile | Drug Info | [83] | |||
62 | 2-Amino-4,6-di-thiophen-2-yl-nicotinonitrile | Drug Info | [83] | |||
63 | 2-Amino-4,6-diphenyl-nicotinonitrile | Drug Info | [83] | |||
64 | 2-Amino-4,6-diphenyl-pyrimidin-5-carbonitrile | Drug Info | [76] | |||
65 | 2-Amino-4,6-diphenyl-pyrimidine | Drug Info | [76] | |||
66 | 2-Amino-4-furan-2-yl-6-phenyl-nicotinonitrile | Drug Info | [83] | |||
67 | 2-Amino-4-phenyl-6-thiophen-2-yl-nicotinonitrile | Drug Info | [83] | |||
68 | 2-Amino-6-furan-2-yl-4-phenyl-nicotinonitrile | Drug Info | [83] | |||
69 | 2-amino-6-phenyl-4-p-tolylnicotinonitrile | Drug Info | [84] | |||
70 | 2-Amino-6-phenyl-4-thiophen-2-yl-nicotinonitrile | Drug Info | [83] | |||
71 | 2-amino-N-benzyl-6-phenyl-9H-purine-9-carboxamide | Drug Info | [85] | |||
72 | 2-azido-N6-methyl-9-(beta-D-ribofuranosyl)adenine | Drug Info | [86] | |||
73 | 2-chloro-2'-C-methyl-tecadenoson | Drug Info | [71] | |||
74 | 2-chloro-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [87] | |||
75 | 2-chloro-4-(thiophen-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [87] | |||
76 | 2-Cyclopentyl-1H-imidazo[4,5-c]quinolin-4-ylamine | Drug Info | [63] | |||
77 | 2-ethyl-4-(furan-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [87] | |||
78 | 2-ethyl-4-(furan-3-yl)thieno[3,2-d]pyrimidine | Drug Info | [87] | |||
79 | 2-ethyl-4-(pyridin-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [87] | |||
80 | 2-ethyl-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [87] | |||
81 | 2-ethyl-4-(thiophen-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [87] | |||
82 | 2-ethynyl-N6-methoxyadenosine | Drug Info | [81] | |||
83 | 2-m-tolyl-2H-pyrazolo[3,4-c]quinolin-4(5H)-one | Drug Info | [89] | |||
84 | 2-m-tolyl-2H-pyrazolo[3,4-c]quinolin-4-amine | Drug Info | [89] | |||
85 | 2-p-tolyl-2H-pyrazolo[3,4-c]quinolin-4(5H)-one | Drug Info | [89] | |||
86 | 2-p-tolyl-2H-pyrazolo[3,4-c]quinolin-4-amine | Drug Info | [89] | |||
87 | 2-Phenyl-1H-imidazo[4,5-c]quinolin-4-ylamine | Drug Info | [63] | |||
88 | 2-phenyl-2H-pyrazolo[3,4-c]quinolin-4(5H)-one | Drug Info | [89] | |||
89 | 2-phenyl-2H-pyrazolo[3,4-c]quinolin-4-amine | Drug Info | [89] | |||
90 | 2-phenylpropoxyadenosine | Drug Info | [78] | |||
91 | 2-tolyl-6-phenyl-9H-purine | Drug Info | [74] | |||
92 | 2-[(4-acetylphenyl)ethynyl]-N6-methoxyadenosine | Drug Info | [81] | |||
93 | 2-[(4-fluorophenyl)ethynyl]-N6-methoxyadenosine | Drug Info | [81] | |||
94 | 3,4-Dichloro-N-(4-phenyl-thiazol-2-yl)-benzamide | Drug Info | [72] | |||
95 | 3-(3-chloro-1H-pyrazol-5-yl)quinoxalin-2(1H)-one | Drug Info | [77] | |||
96 | 3-Benzyl-7-methyl-[1,8]naphthyridin-4-ol | Drug Info | [90] | |||
97 | 3-Benzyl-7-methyl-[1,8]naphthyridine-4-thiol | Drug Info | [90] | |||
98 | 3-Chloro-N-(4-phenyl-thiazol-2-yl)-benzamide | Drug Info | [72] | |||
99 | 3-noradamantyl-1,3-dipropylxanthine | Drug Info | [91] | |||
100 | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [92] | |||
101 | 4-(ethylthio)-6-phenyl-1,3,5-triazin-2-amine | Drug Info | [84] | |||
102 | 4-(furan-2-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine | Drug Info | [93] | |||
103 | 4-(furan-2-yl)thieno[3,2-d]pyrimidin-2-amine | Drug Info | [85] | |||
104 | 4-(thiazol-2-yl)thieno[3,2-d]pyrimidin-2-amine | Drug Info | [87] | |||
105 | 4-Amino-2,6-diphenyl-pyrimidine-5-carbonitrile | Drug Info | [76] | |||
106 | 4-Bromo-N-(4-phenyl-thiazol-2-yl)-benzamide | Drug Info | [72] | |||
107 | 4-Chloro-7-methyl-2-phenyl-[1,8]naphthyridine | Drug Info | [94] | |||
108 | 4-Chloro-N-(4-phenyl-thiazol-2-yl)-benzamide | Drug Info | [72] | |||
109 | 4-Methoxy-N-(3-phenyl-isoquinolin-1-yl)-benzamide | Drug Info | [72] | |||
110 | 4-Methyl-N-(4-phenyl-thiazol-2-yl)-benzamide | Drug Info | [72] | |||
111 | 4-Nitro-N-(4-phenyl-thiazol-2-yl)-benzamide | Drug Info | [72] | |||
112 | 4-tert-Butyl-N-(4-phenyl-thiazol-2-yl)-benzamide | Drug Info | [72] | |||
113 | 5,7-dibromo-9H-pyrido[3,4-b]indol-6-ol | Drug Info | [96] | |||
114 | 5,7-diphenyl-3H-imidazo[4,5-b]pyridin-2-ol | Drug Info | [75] | |||
115 | 6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [93] | |||
116 | 6-ethylamino-2-(3''-indolyl)ethyloxy)adenosine | Drug Info | [78] | |||
117 | 6-guanidino-2-(3''-indolylethyloxy)adenosine | Drug Info | [78] | |||
118 | 7-(3,6,9,12-tetraoxatricos-22-enyl)theophylline | Drug Info | [97] | |||
119 | 7-Bromo-2-phenyl-[1,8]naphthyridin-4-ol | Drug Info | [98] | |||
120 | 7-Chloro-2-phenyl-[1,8]naphthyridin-4-ol | Drug Info | [98] | |||
121 | 7-Dimethylamino-2-phenyl-[1,8]naphthyridin-4-ol | Drug Info | [98] | |||
122 | 7-Methyl-2-propyl-[1,8]naphthyridin-4-ol | Drug Info | [98] | |||
123 | 8-Bromo-9-(2,3-dihydroxypropyl)-9H-adenine | Drug Info | [99] | |||
124 | 8-Bromo-9-(2-butyl)-9H-adenine | Drug Info | [99] | |||
125 | 8-Bromo-9-(2-hydroxypropyl)-9H-adenine | Drug Info | [99] | |||
126 | 8-Bromo-9-(3-hydroxypropyl)-9H-adenine | Drug Info | [99] | |||
127 | 8-Bromo-9-(but-3-enyl)-9H-adenine | Drug Info | [99] | |||
128 | 8-Bromo-9-(sec-butyl)-9H-adenine | Drug Info | [99] | |||
129 | 8-Bromo-9-cyclobutyl-9H-adenine | Drug Info | [99] | |||
130 | 8-Bromo-9-cyclohexyl-9H-adenine | Drug Info | [99] | |||
131 | 8-Bromo-9-cyclopentyl-9H-adenine | Drug Info | [99] | |||
132 | 8-Bromo-9-ethyl-9H-adenine | Drug Info | [99] | |||
133 | 8-bromo-9-isobutyl-9H-purin-6-amine | Drug Info | [82] | |||
134 | 8-Bromo-9-isopropyl-9H-adenine | Drug Info | [99] | |||
135 | 8-Bromo-9-methyl-9H-adenine | Drug Info | [99] | |||
136 | 8-Bromo-9-phenylethyl-9H-adenine | Drug Info | [99] | |||
137 | 8-Bromo-9-propyl-9H-adenine | Drug Info | [99] | |||
138 | 8-cyclohexyl-6-(4-tolyl)-2-phenyl-9H-purine | Drug Info | [74] | |||
139 | 8-PHENYL THEOPHYLLINE | Drug Info | [63] | |||
140 | 8-Phenyl-1-propyl-3,7-dihydro-purine-2,6-dione | Drug Info | [101] | |||
141 | 8-Phenyl-3,7-dihydro-purine-2,6-dione | Drug Info | [101] | |||
142 | 8-propyl-2,6-diphenyl-9H-purine | Drug Info | [74] | |||
143 | 9-(3-aminobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [85] | |||
144 | 9-(3-nitrobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [85] | |||
145 | 9-(4-nitrobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [85] | |||
146 | 9-Allyl-8-bromo-9H-adenine | Drug Info | [99] | |||
147 | 9-benzyl-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [85] | |||
148 | 9-Benzyl-8-bromo-9H-adenine | Drug Info | [99] | |||
149 | 9-Cyclobutyl-9H-adenine | Drug Info | [99] | |||
150 | 9-Cyclopentyl-9H-adenine | Drug Info | [62] | |||
151 | 9-Ethyl-8-phenylethynyl-9H-purin-6-ylamine | Drug Info | [102] | |||
152 | 9-Ethyl-9H-adenine | Drug Info | [99] | |||
153 | 9-Isopropyl-9H-adenine | Drug Info | [99] | |||
154 | 9-Methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine | Drug Info | [103] | |||
155 | 9-Methyl-9H-adenine | Drug Info | [59] | |||
156 | 9-Phenyl-9H-purin-6-ylamine | Drug Info | [62] | |||
157 | 9-Propyl-9H-adenine | Drug Info | [99] | |||
158 | A-987306 | Drug Info | [104] | |||
159 | Anthoptilide C | Drug Info | [105] | |||
160 | Cirsimarin | Drug Info | [108] | |||
161 | Cyclohexyl-(2-phenylsulfanyl-9H-purin-6-yl)-amine | Drug Info | [111] | |||
162 | Cyclohexyl-(9-ethyl-9H-purin-6-yl)-amine | Drug Info | [62] | |||
163 | Cyclohexyl-(9-methyl-9H-purin-6-yl)-amine | Drug Info | [62] | |||
164 | Cyclopentyl-(9-cyclopentyl-9H-purin-6-yl)-amine | Drug Info | [62] | |||
165 | Cyclopentyl-(9-ethyl-9H-purin-6-yl)-amine | Drug Info | [62] | |||
166 | Cyclopentyl-(9-methyl-9H-purin-6-yl)-amine | Drug Info | [62] | |||
167 | Cyclopentyl-(9-phenyl-9H-purin-6-yl)-amine | Drug Info | [62] | |||
168 | DEPX | Drug Info | [112] | |||
169 | Ethyl 5-benzoyl-4-phenylthiazol-2-ylcarbamate | Drug Info | [41] | |||
170 | FR-166124 | Drug Info | [113] | |||
171 | GNF-PF-2224 | Drug Info | [115], [116], [117], [118] | |||
172 | GNF-PF-2700 | Drug Info | [82] | |||
173 | Hexanoic Acid (2,6-diphenylpyrimidin-4-yl)amide | Drug Info | [119] | |||
174 | Isoguanosine | Drug Info | [122] | |||
175 | Kuanoniamine D | Drug Info | [124] | |||
176 | L-249313 | Drug Info | [45] | |||
177 | LUF-5417 | Drug Info | [41] | |||
178 | LUF-5433 | Drug Info | [41] | |||
179 | LUF-5735 | Drug Info | [119] | |||
180 | LUF-5737 | Drug Info | [119] | |||
181 | LUF-5764 | Drug Info | [119] | |||
182 | LUF-5767 | Drug Info | [119] | |||
183 | LUF-5816 | Drug Info | [75] | |||
184 | LUF-5853 | Drug Info | [76] | |||
185 | LUF-5956 | Drug Info | [74] | |||
186 | LUF-5957 | Drug Info | [74] | |||
187 | LUF-5962 | Drug Info | [74] | |||
188 | LUF-5978 | Drug Info | [75] | |||
189 | LUF-5980 | Drug Info | [75] | |||
190 | LUF-5981 | Drug Info | [75] | |||
191 | LUF-6258 | Drug Info | [126] | |||
192 | N*6*-Cyclohexyl-N*2*-ethyl-9H-purine-2,6-diamine | Drug Info | [111] | |||
193 | N*6*-Cyclohexyl-N*2*-phenyl-9H-purine-2,6-diamine | Drug Info | [111] | |||
194 | N*6*-Cyclooctyl-N*2*-phenyl-9H-purine-2,6-diamine | Drug Info | [111] | |||
195 | N-(2,6-diphenylpyrimidin-4-yl)-2-ethylbutyramide | Drug Info | [119] | |||
196 | N-(2,6-diphenylpyrimidin-4-yl)-3-methylbutyramide | Drug Info | [119] | |||
197 | N-(2,6-diphenylpyrimidin-4-yl)acetamide | Drug Info | [119] | |||
198 | N-(2,6-diphenylpyrimidin-4-yl)benzamide | Drug Info | [119] | |||
199 | N-(2,6-diphenylpyrimidin-4-yl)butyramide | Drug Info | [119] | |||
200 | N-(2,6-diphenylpyrimidin-4-yl)isobutyramide | Drug Info | [119] | |||
201 | N-(2,6-diphenylpyrimidin-4-yl)propionamide | Drug Info | [119] | |||
202 | N-(2-(furan-2-yl)-3,4'-bipyridin-6-yl)acetamide | Drug Info | [131] | |||
203 | N-(4,5-diphenylpyrimidin-2-yl)acetamide | Drug Info | [119] | |||
204 | N-(4,6-diphenylpyrimidin-2-yl)-2-ethylbutyramide | Drug Info | [119] | |||
205 | N-(4,6-diphenylpyrimidin-2-yl)-3-chlorobenzamide | Drug Info | [119] | |||
206 | N-(4,6-diphenylpyrimidin-2-yl)-3-methylbutyramide | Drug Info | [119] | |||
207 | N-(4,6-diphenylpyrimidin-2-yl)benzamide | Drug Info | [119] | |||
208 | N-(4,6-diphenylpyrimidin-2-yl)propionamide | Drug Info | [119] | |||
209 | N-(4-Phenyl-thiazol-2-yl)-benzamide | Drug Info | [72] | |||
210 | N-(5-Benzoyl-4-phenylthiazol-2-yl)benzamide | Drug Info | [41] | |||
211 | N6-((+/-)-endo-norborn-2-yl)adenosine | Drug Info | [73] | |||
212 | N6-CYCLOPENTYLADENOSINE | Drug Info | [71] | |||
213 | N6-methoxy-2-phenylethynyladenosine | Drug Info | [81] | |||
214 | N6-methoxy-2-[(2-pyridinyl)ethynyl]adenosine | Drug Info | [81] | |||
215 | N6-methoxy-2-[(3-pyridinyl)ethynyl]-adenosine | Drug Info | [81] | |||
216 | N6-methoxy-2-[(4-methoxyphenyl)ethynyl]adenosine | Drug Info | [81] | |||
217 | N6-methoxy-2-[(4-methylphenyl)ethynyl]adenosine | Drug Info | [81] | |||
218 | N6-methoxy-2-[(4-pentylphenyl)ethynyl]adenosine | Drug Info | [81] | |||
219 | N6-methoxy-2-[(4-pyridinyl)ethynyl]adenosine | Drug Info | [81] | |||
220 | N6-methoxy-2-[2-(trimethylsilyl)ethynyl]adenosine | Drug Info | [81] | |||
221 | N6-[(4-Amino)-phenyl]-9-benzyl-2-phenyladenine | Drug Info | [132] | |||
222 | N6-[(4-Nitro)-phenyl]-9-benzyl-2-phenyladenine | Drug Info | [132] | |||
223 | P-IODOAMPHETAMINE | Drug Info | [133] | |||
224 | PD-115199 | Drug Info | [134] | |||
225 | PD-81723 | Drug Info | [135] | |||
226 | Pentanoic acid (4,6-diphenylpyrimidin-2-yl)amide | Drug Info | [119] | |||
227 | Phenyl(2-(trifluoromethyl)quinolin-4-yl)methanol | Drug Info | [136] | |||
228 | Phenyl-(9-phenyl-9H-purin-6-yl)-amine | Drug Info | [62] | |||
229 | PSB-0788 | Drug Info | [137] | |||
230 | PSB-1115 | Drug Info | [137] | |||
231 | PSB-601 | Drug Info | [137] | |||
232 | R-N6-(phenylisopropyl)adenosine | Drug Info | [140], [78] | |||
233 | SB-298 | Drug Info | [137] | |||
234 | SCH-63390 | Drug Info | [141] | |||
235 | ST-1535 | Drug Info | [103] | |||
236 | VCP-28 | Drug Info | [143] | |||
237 | VUF-8507 | Drug Info | [144] | |||
238 | [3H]NECA | Drug Info | [149] | |||
239 | [3H]OSIP339391 | Drug Info | [82] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 5 KEGG Pathways | + | ||||
1 | cGMP-PKG signaling pathway | |||||
2 | cAMP signaling pathway | |||||
3 | Sphingolipid signaling pathway | |||||
4 | Neuroactive ligand-receptor interaction | |||||
5 | Morphine addiction | |||||
NetPath Pathway | [+] 2 NetPath Pathways | + | ||||
1 | TCR Signaling Pathway | |||||
2 | RANKL Signaling Pathway | |||||
Panther Pathway | [+] 2 Panther Pathways | + | ||||
1 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
2 | Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Adenosine P1 receptors | |||||
2 | G alpha (i) signalling events | |||||
WikiPathways | [+] 4 WikiPathways | + | ||||
1 | Nucleotide GPCRs | |||||
2 | GPCRs, Class A Rhodopsin-like | |||||
3 | GPCR ligand binding | |||||
4 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation | ||||||
Target QSAR Model |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Caffeine as a psychomotor stimulant: mechanism of action. Cell Mol Life Sci. 2004 Apr;61(7-8):857-72. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 407). | |||||
REF 3 | Fatigue: an overview. Am Fam Physician. 2008 Nov 15;78(10):1173-9. | |||||
REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5604). | |||||
REF 5 | Association between the PDE4D gene and ischaemic stroke in the Chinese Han population. Clin Sci (Lond). 2009 Aug 17;117(7):265-72. | |||||
REF 6 | Recent developments in adenosine receptor ligands and their potential as novel drugs. Biochim Biophys Acta. 2011 May; 1808(5): 1290-1308. | |||||
REF 7 | Xanthines as Adenosine Receptor Antagonists. Handb Exp Pharmacol. 2011; (200): 10.1007/978-3-642-13443-2_6. | |||||
REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035637) | |||||
REF 9 | ClinicalTrials.gov (NCT00568945) Study to Investigate the Effect of the A1 Agonist Capadenoson on Ventricular HR in Patients With Persistent or Permanent Atrial Fibrillation.. U.S. National Institutes of Health. | |||||
REF 10 | ClinicalTrials.gov (NCT00040001) Safety and Efficacy Study of an A1-Adenosine Receptor Agonist to Slow Heart Rate in Atrial Fibrillation. U.S. National Institutes of Health. | |||||
REF 11 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3281). | |||||
REF 12 | Role of matrix metalloproteinases and their tissue inhibitors as potential biomarkers of left ventricular remodelling in the athlete's heart. Clin Sci (Lond). 2009 Jul 16;117(4):157-64. | |||||
REF 13 | Emerging drugs for acute and chronic heart failure: current and future developments. Expert Opin Emerg Drugs. 2007 Mar;12(1):75-95. | |||||
REF 14 | ClinicalTrials.gov (NCT01123785) A Dose-Escalation Study Designed to Evaluate the Tolerability, Safety, Pharmacokinetics (PK), and Efficacy of Chronic Topical Ocular Application of INO-8875 in AdultsWith Ocular Hypertension or Primary Open-Angle Glaucoma. U.S. National Institutes of Health. | |||||
REF 15 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5593). | |||||
REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018030) | |||||
REF 17 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005980) | |||||
REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015498) | |||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003285) | |||||
REF 20 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5592). | |||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010504) | |||||
REF 22 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004678) | |||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005374) | |||||
REF 24 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5606). | |||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001559) | |||||
REF 26 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005145) | |||||
REF 27 | Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26. | |||||
REF 28 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3288). | |||||
REF 29 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001436) | |||||
REF 30 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003507) | |||||
REF 31 | Circadian rhythm as a therapeutic target. Nat Rev Drug Discov. 2021 Apr;20(4):287-307. | |||||
REF 32 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000987) | |||||
REF 33 | Adenosine receptor antagonists intensify the benzodiazepine withdrawal signs in mice. Pharmacol Rep. 2006 Sep-Oct;58(5):643-51. | |||||
REF 34 | Adenosine A1/A2a receptor agonist AMP-579 induces acute and delayed preconditioning against in vivo myocardial stunning. Am J Physiol Heart Circ Physiol. 2004 Dec;287(6):H2746-53. | |||||
REF 35 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004779) | |||||
REF 36 | Separation of on-target efficacy from adverse effects through rational design of a bitopic adenosine receptor agonist. Current Issue vol. 111 no. 12 Celine Valant, 4614-4619. | |||||
REF 37 | A1 adenosine receptor agonists and their potential therapeutic applications. Expert Opin Investig Drugs. 2008 Dec;17(12):1901-10. | |||||
REF 38 | Recent developments in adenosine receptor ligands and their potential as novel drugs. Biochim Biophys Acta. 2011 May;1808(5):1290-308. | |||||
REF 39 | International Union of Basic and Clinical Pharmacology. LXXXI. Nomenclature and classification of adenosine receptors--an update. Pharmacol Rev. 2011 Mar;63(1):1-34. | |||||
REF 40 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 41 | 2-Amino-5-benzoyl-4-phenylthiazoles: Development of potent and selective adenosine A1 receptor antagonists. Bioorg Med Chem. 2010 Mar 15;18(6):2195-2203. | |||||
REF 42 | Effects of BG9928, an adenosine A receptor antagonist, in patients with congestive heart failure.J Clin Pharmacol.2011 Jun;51(6):899-907. | |||||
REF 43 | INO-8875, a highly selective A1 adenosine receptor agonist: evaluation of chronotropic, dromotropic, and hemodynamic effects in rats. J Pharmacol Exp Ther. 2013 Jan;344(1):59-67. | |||||
REF 44 | Reduction of free fatty acids, safety, and pharmacokinetics of oral GS-9667, an A(1) adenosine receptor partial agonist. J Clin Pharmacol. 2013 Apr;53(4):385-92. | |||||
REF 45 | 2-Alkynyl-8-aryl-9-methyladenines as novel adenosine receptor antagonists: their synthesis and structure-activity relationships toward hepatic gluc... J Med Chem. 2001 Jan 18;44(2):170-9. | |||||
REF 46 | Design, radiosynthesis, and biodistribution of a new potent and selective ligand for in vivo imaging of the adenosine A(2A) receptor system using p... J Med Chem. 2000 Nov 16;43(23):4359-62. | |||||
REF 47 | Carbonic anhydrase inhibitors: a review on the progress of patent literature (2011-2016).Expert Opin Ther Pat. 2016 Aug;26(8):947-56. | |||||
REF 48 | CV Therapeutics. Company report from CV Therapeutics, Inc. CV Therapeutics. 2009. | |||||
REF 49 | Adenosine receptors and cardiovascular disease: the adenosine-1 receptor (A1) and A1 selective ligands. Cardiovasc Toxicol. 2003;3(1):71-88. | |||||
REF 50 | N-0861 selectively antagonizes adenosine A1 receptors in vivo. Eur J Pharmacol. 1992 May 27;216(1):9-16. | |||||
REF 51 | Inhibition of cyclic nucleotide phosphodiesterase by derivatives of 1,3-bis(cyclopropylmethyl)xanthine. J Med Chem. 1994 Feb 18;37(4):476-85. | |||||
REF 52 | Adenosine A1 receptor antagonist improves intradialytic hypotension. Kidney Int. 2006 Mar;69(5):877-83. | |||||
REF 53 | Cardiovascular and renal effects of blocking A1 adenosine receptors. J Cardiovasc Pharmacol. 1993 May;21(5):822-8. | |||||
REF 54 | An orally active adenosine A1 receptor antagonist, FK838, increases renal excretion and maintains glomerular filtration rate in furosemide-resistan... Br J Pharmacol. 2003 Aug;139(8):1383-8. | |||||
REF 55 | Effect of the adenosine A1 receptor agonist GR79236 on trigeminal nociception with blink reflex recordings in healthy human subjects. Cephalalgia. 2003 May;23(4):287-92. | |||||
REF 56 | The cardiac effects of a novel A1-adenosine receptor agonist in guinea pig isolated heart. J Pharmacol Exp Ther. 1994 Dec;271(3):1371-82. | |||||
REF 57 | Protein kinase C protects preconditioned rabbit hearts by increasing sensitivity of adenosine A2b-dependent signaling during early reperfusion. J Mol Cell Cardiol. 2007 Sep;43(3):262-71. | |||||
REF 58 | Methanocarba analogues of purine nucleosides as potent and selective adenosine receptor agonists. J Med Chem. 2000 Jun 1;43(11):2196-203. | |||||
REF 59 | Novel amino acid derived natural products from the ascidian Atriolum robustum: identification and pharmacological characterization of a unique aden... J Med Chem. 2004 Apr 22;47(9):2243-55. | |||||
REF 60 | N-substituted adenosines as novel neuroprotective A(1) agonists with diminished hypotensive effects. J Med Chem. 1999 Sep 9;42(18):3463-77. | |||||
REF 61 | 2-Phenylpyrazolo[4,3-d]pyrimidin-7-one as a new scaffold to obtain potent and selective human A3 adenosine receptor antagonists: new insights into ... J Med Chem. 2009 Dec 10;52(23):7640-52. | |||||
REF 62 | N6,9-disubstituted adenines: potent, selective antagonists at the A1 adenosine receptor. J Med Chem. 1991 Sep;34(9):2877-82. | |||||
REF 63 | 1H-imidazo[4,5-c]quinolin-4-amines: novel non-xanthine adenosine antagonists. J Med Chem. 1991 Mar;34(3):1202-6. | |||||
REF 64 | Structure-activity relationships of 8-styrylxanthines as A2-selective adenosine antagonists. J Med Chem. 1993 May 14;36(10):1333-42. | |||||
REF 65 | N(6)-alkyl-2-alkynyl derivatives of adenosine as potent and selective agonists at the human adenosine A(3) receptor and a starting point for searching A(2B) ligands. J Med Chem. 2002 Jul 18;45(15):3271-9. | |||||
REF 66 | A threonine residue in the seventh transmembrane domain of the human A1 adenosine receptor mediates specific agonist binding. J Biol Chem. 1994 Jan 28;269(4):2373-6. | |||||
REF 67 | Benzo[1,2-c:5,4-c']dipyrazoles: non-xanthine adenosine antagonists. J Med Chem. 1988 Oct;31(10):2034-9. | |||||
REF 68 | Preparation, properties, reactions, and adenosine receptor affinities of sulfophenylxanthine nitrophenyl esters: toward the development of sulfonic... J Med Chem. 2004 Feb 12;47(4):1031-43. | |||||
REF 69 | Effects of 8-phenyl and 8-cycloalkyl substituents on the activity of mono-, di-, and trisubstituted alkylxanthines with substitution at the 1-, 3-,... J Med Chem. 1989 Jun;32(6):1231-7. | |||||
REF 70 | Structure-activity relationships at human and rat A2B adenosine receptors of xanthine derivatives substituted at the 1-, 3-, 7-, and 8-positions. J Med Chem. 2002 May 23;45(11):2131-8. | |||||
REF 71 | 5'-Carbamoyl derivatives of 2'-C-methyl-purine nucleosides as selective A1 adenosine receptor agonists: affinity, efficacy, and selectivity for A1 ... Bioorg Med Chem. 2008 Jan 1;16(1):336-53. | |||||
REF 72 | Substituted 4-phenyl-2-(phenylcarboxamido)-1,3-thiazole derivatives as antagonists for the adenosine A(1) receptor. Bioorg Med Chem Lett. 2001 Aug 6;11(15):2017-9. | |||||
REF 73 | N6-Cycloalkyl- and N6-bicycloalkyl-C5'(C2')-modified adenosine derivatives as high-affinity and selective agonists at the human A1 adenosine recept... J Med Chem. 2009 Apr 23;52(8):2393-406. | |||||
REF 74 | 2,6-disubstituted and 2,6,8-trisubstituted purines as adenosine receptor antagonists. J Med Chem. 2006 May 18;49(10):2861-7. | |||||
REF 75 | 2,6,8-trisubstituted 1-deazapurines as adenosine receptor antagonists. J Med Chem. 2007 Feb 22;50(4):828-34. | |||||
REF 76 | A new generation of adenosine receptor antagonists: from di- to trisubstituted aminopyrimidines. Bioorg Med Chem. 2008 Mar 15;16(6):2741-52. | |||||
REF 77 | Derivatives of 4-amino-6-hydroxy-2-mercaptopyrimidine as novel, potent, and selective A3 adenosine receptor antagonists. J Med Chem. 2008 Mar 27;51(6):1764-70. | |||||
REF 78 | Structure-activity relationships of 2,N(6),5'-substituted adenosine derivatives with potent activity at the A2B adenosine receptor. J Med Chem. 2007 Apr 19;50(8):1810-27. | |||||
REF 79 | Identification of novel, water-soluble, 2-amino-N-pyrimidin-4-yl acetamides as A2A receptor antagonists with in vivo efficacy. J Med Chem. 2008 Feb 14;51(3):400-6. | |||||
REF 80 | 2-(Benzimidazol-2-yl)quinoxalines: a novel class of selective antagonists at human A(1) and A(3) adenosine receptors designed by 3D database search... J Med Chem. 2005 Dec 29;48(26):8253-60. | |||||
REF 81 | N6-methoxy-2-alkynyladenosine derivatives as highly potent and selective ligands at the human A3 adenosine receptor. J Med Chem. 2007 Mar 22;50(6):1222-30. | |||||
REF 82 | Insights into binding modes of adenosine A(2B) antagonists with ligand-based and receptor-based methods. Eur J Med Chem. 2010 Aug;45(8):3459-71. | |||||
REF 83 | 2-Amino-6-furan-2-yl-4-substituted nicotinonitriles as A2A adenosine receptor antagonists. J Med Chem. 2008 Aug 14;51(15):4449-55. | |||||
REF 84 | Identification of non-furan containing A2A antagonists using database mining and molecular similarity approaches. Bioorg Med Chem Lett. 2006 Dec 1;16(23):5993-7. | |||||
REF 85 | Antagonists of the human adenosine A2A receptor. Part 3: Design and synthesis of pyrazolo[3,4-d]pyrimidines, pyrrolo[2,3-d]pyrimidines and 6-arylpu... Bioorg Med Chem Lett. 2008 May 1;18(9):2924-9. | |||||
REF 86 | 2-triazole-substituted adenosines: a new class of selective A3 adenosine receptor agonists, partial agonists, and antagonists. J Med Chem. 2006 Dec 14;49(25):7373-83. | |||||
REF 87 | Antagonists of the human adenosine A2A receptor. Part 2: Design and synthesis of 4-arylthieno[3,2-d]pyrimidine derivatives. Bioorg Med Chem Lett. 2008 May 1;18(9):2920-3. | |||||
REF 88 | Identification of the adenine binding site of the human A1 adenosine receptor. J Biol Chem. 1999 Feb 5;274(6):3617-21. | |||||
REF 89 | New 2-arylpyrazolo[3,4-c]quinoline derivatives as potent and selective human A3 adenosine receptor antagonists. Synthesis, pharmacological evaluati... J Med Chem. 2007 Aug 23;50(17):4061-74. | |||||
REF 90 | 1,8-Naphthyridin-4-one derivatives as new ligands of A2A adenosine receptors. Bioorg Med Chem Lett. 2005 Oct 15;15(20):4604-10. | |||||
REF 91 | Potent and orally bioavailable 8-bicyclo[2.2.2]octylxanthines as adenosine A1 receptor antagonists. J Med Chem. 2006 Nov 30;49(24):7119-31. | |||||
REF 92 | Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97. | |||||
REF 93 | Antagonists of the human A(2A) adenosine receptor. 4. Design, synthesis, and preclinical evaluation of 7-aryltriazolo[4,5-d]pyrimidines. J Med Chem. 2009 Jan 8;52(1):33-47. | |||||
REF 94 | A novel class of highly potent and selective A1 adenosine antagonists: structure-affinity profile of a series of 1,8-naphthyridine derivatives. J Med Chem. 2000 Jul 27;43(15):2814-23. | |||||
REF 95 | Synthesis and biological activities of flavonoid derivatives as A3 adenosine receptor antagonists. J Med Chem. 1996 Jun 7;39(12):2293-301. | |||||
REF 96 | Synthesis of eudistomin D analogues and its effects on adenosine receptors. Bioorg Med Chem. 2008 Apr 1;16(7):3825-30. | |||||
REF 97 | Synthesis of theophylline derivatives and study of their activity as antagonists at adenosine receptors. Bioorg Med Chem. 2010 Mar 15;18(6):2081-2088. | |||||
REF 98 | Study on affinity profile toward native human and bovine adenosine receptors of a series of 1,8-naphthyridine derivatives. J Med Chem. 2004 Jun 3;47(12):3019-31. | |||||
REF 99 | 8-Bromo-9-alkyl adenine derivatives as tools for developing new adenosine A2A and A2B receptors ligands. Bioorg Med Chem. 2009 Apr 1;17(7):2812-22. | |||||
REF 100 | Thermodynamics of full agonist, partial agonist, and antagonist binding to wild-type and mutant adenosine A1 receptors. Biochem Pharmacol. 1998 Dec 1;56(11):1437-45. | |||||
REF 101 | Synthesis of paraxanthine analogs (1,7-disubstituted xanthines) and other xanthines unsubstituted at the 3-position: structure-activity relationshi... J Med Chem. 1993 Oct 29;36(22):3341-9. | |||||
REF 102 | Introduction of alkynyl chains on C-8 of adenosine led to very selective antagonists of the A(3) adenosine receptor. Bioorg Med Chem Lett. 2001 Jul 23;11(14):1931-4. | |||||
REF 103 | 2-n-Butyl-9-methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine and analogues as A2A adenosine receptor antagonists. Design, synthesis, and pharmacolog... J Med Chem. 2005 Nov 3;48(22):6887-96. | |||||
REF 104 | cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain... J Med Chem. 2008 Nov 27;51(22):7094-8. | |||||
REF 105 | Anthoptilides A-E, new Briarane diterpenes from the Australian sea pen Anthoptilum cf. kukenthali. J Nat Prod. 2000 Mar;63(3):318-21. | |||||
REF 106 | Pharmacological characterization of novel adenosine ligands in recombinant and native human A2B receptors. Biochem Pharmacol. 2005 Nov 25;70(11):1601-12. | |||||
REF 107 | Anilide derivatives of an 8-phenylxanthine carboxylic congener are highly potent and selective antagonists at human A(2B) adenosine receptors. J Med Chem. 2000 Mar 23;43(6):1165-72. | |||||
REF 108 | Adenosine-1 active ligands: cirsimarin, a flavone glycoside from Microtea debilis. J Nat Prod. 1997 Jun;60(6):638-41. | |||||
REF 109 | Adenosine receptors as therapeutic targets. Nat Rev Drug Discov. 2006 Mar;5(3):247-64. | |||||
REF 110 | Synthesis and evaluation of no-carrier-added 8-cyclopentyl-3-(3-[(18)F]fluoropropyl)-1-propylxanthine ([(18)F]CPFPX): a potent and selective A(1)-adenosine receptor antagonist for in vivo imaging. J Med Chem. 2002 Nov 7;45(23):5150-6. | |||||
REF 111 | Reversine and its 2-substituted adenine derivatives as potent and selective A3 adenosine receptor antagonists. J Med Chem. 2005 Jul 28;48(15):4910-8. | |||||
REF 112 | 125I-labeled 8-phenylxanthine derivatives: antagonist radioligands for adenosine A1 receptors. J Med Chem. 1988 Apr;31(4):745-51. | |||||
REF 113 | Discovery of FR166124, a novel water-soluble pyrazolo-[1,5-a]pyridine adenosine A1 receptor antagonist. Bioorg Med Chem Lett. 1999 Jul 19;9(14):1979-84. | |||||
REF 114 | Pharmacological characterization of FR194921, a new potent, selective, and orally active antagonist for central adenosine A1 receptors. J Pharmacol Sci. 2004 Sep;96(1):42-52. | |||||
REF 115 | Minoxidil-induced hair growth is mediated by adenosine in cultured dermal papilla cells: possible involvement of sulfonylurea receptor 2B as a target of minoxidil. J Invest Dermatol. 2001 Dec;117(6):1594-600. | |||||
REF 116 | Influence of the antagonist of adenosine A1 receptors, 8-cyclopentyl-1 ,3-dipropylxanthine, upon the anticonvulsant activity of antiepileptic drugs in mice. Przegl Lek. 2008;65(11):759-63. | |||||
REF 117 | Potent adenosine receptor antagonists that are selective for the A1 receptor subtype. Mol Pharmacol. 1987 Mar;31(3):247-52. | |||||
REF 118 | Synthesis and theoretical studies on energetics of novel N- and O- perfluoroalkyl triazole tagged thienopyrimidines--their potential as adenosine r... Eur J Med Chem. 2010 May;45(5):1739-45. | |||||
REF 119 | 2,4,6-trisubstituted pyrimidines as a new class of selective adenosine A1 receptor antagonists. J Med Chem. 2004 Dec 16;47(26):6529-40. | |||||
REF 120 | Species difference in the G protein selectivity of the human and bovine A1-adenosine receptor. J Biol Chem. 1994 Dec 23;269(51):32077-84. | |||||
REF 121 | Adenosine receptors: targets for future drugs. J Med Chem. 1982 Mar;25(3):197-207. | |||||
REF 122 | High selectivity of novel isoguanosine analogues for the adenosine A1 receptor. Bioorg. Med. Chem. Lett. 1(9):481-486 (1991). | |||||
REF 123 | KF26777 (2-(4-bromophenyl)-7,8-dihydro-4-propyl-1H-imidazo[2,1-i]purin-5(4H)-one dihydrochloride), a new potent and selective adenosine A3 receptor antagonist. Eur J Pharmacol. 2002 May 31;444(3):133-41. | |||||
REF 124 | Bioactive pyridoacridine alkaloids from the micronesian sponge Oceanapia sp. J Nat Prod. 1998 Feb;61(2):301-5. | |||||
REF 125 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 18). | |||||
REF 126 | Hybrid ortho/allosteric ligands for the adenosine A(1) receptor. J Med Chem. 2010 Apr 22;53(8):3028-37. | |||||
REF 127 | Allosteric modulation, thermodynamics and binding to wild-type and mutant (T277A) adenosine A1 receptors of LUF5831, a novel nonadenosine-like agonist. Br J Pharmacol. 2006 Mar;147(5):533-41. | |||||
REF 128 | Design, synthesis, and biological evaluation of new 8-heterocyclic xanthine derivatives as highly potent and selective human A2B adenosine receptor antagonists. J Med Chem. 2004 Mar 11;47(6):1434-47. | |||||
REF 129 | Design of (N)-methanocarba adenosine 5'-uronamides as species-independent A3 receptor-selective agonists. Bioorg Med Chem Lett. 2008 May 1;18(9):2813-9. | |||||
REF 130 | Structure-activity relationships for 2-substituted adenosines at A1 and A2 adenosine receptors. Pharmacology. 1993;46(2):91-100. | |||||
REF 131 | Discovery of N-(5,6-diarylpyridin-2-yl)amide derivatives as potent and selective A(2B) adenosine receptor antagonists. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1697-700. | |||||
REF 132 | N6-1,3-diphenylurea derivatives of 2-phenyl-9-benzyladenines and 8-azaadenines: synthesis and biological evaluation as allosteric modulators of A2A... Eur J Med Chem. 2008 Aug;43(8):1639-47. | |||||
REF 133 | Synthesis and biological activity of N6-(p-sulfophenyl)alkyl and N6-sulfoalkyl derivatives of adenosine: water-soluble and peripherally selective a... J Med Chem. 1992 Oct 30;35(22):4143-9. | |||||
REF 134 | (E)-1,3-dialkyl-7-methyl-8-(3,4,5-trimethoxystyryl)xanthines: potent and selective adenosine A2 antagonists. J Med Chem. 1992 Jun 12;35(12):2342-5. | |||||
REF 135 | Synthesis and biological evaluation of 2-amino-3-(4-chlorobenzoyl)-4-[N-(substituted) piperazin-1-yl]thiophenes as potent allosteric enhancers of t... J Med Chem. 2008 Sep 25;51(18):5875-9. | |||||
REF 136 | Antagonists of the human adenosine A2A receptor. Part 1: Discovery and synthesis of thieno[3,2-d]pyrimidine-4-methanone derivatives. Bioorg Med Chem Lett. 2008 May 1;18(9):2916-9. | |||||
REF 137 | 1-alkyl-8-(piperazine-1-sulfonyl)phenylxanthines: development and characterization of adenosine A2B receptor antagonists and a new radioligand with... J Med Chem. 2009 Jul 9;52(13):3994-4006. | |||||
REF 138 | 2-Phenylimidazo[2,1-i]purin-5-ones: structure-activity relationships and characterization of potent and selective inverse agonists at Human A3 adenosine receptors. Bioorg Med Chem. 2003 Feb 6;11(3):347-56. | |||||
REF 139 | Antinociceptive effects of novel A2B adenosine receptor antagonists. J Pharmacol Exp Ther. 2004 Jan;308(1):358-66. | |||||
REF 140 | Comparative pharmacology of human adenosine receptor subtypes - characterization of stably transfected receptors in CHO cells. Naunyn Schmiedebergs Arch Pharmacol. 1998 Jan;357(1):1-9. | |||||
REF 141 | Design, synthesis, and biological evaluation of a second generation of pyrazolo[4,3-e]-1,2,4-triazolo[1,5-c]pyrimidines as potent and selective A2A... J Med Chem. 1998 Jun 4;41(12):2126-33. | |||||
REF 142 | N6-cyclopentyl-2-(3-phenylaminocarbonyltriazene-1-yl)adenosine (TCPA), a very selective agonist with high affinity for the human adenosine A1 receptor. J Med Chem. 2003 Apr 10;46(8):1492-503. | |||||
REF 143 | Synthesis and evaluation of new N6-substituted adenosine-5'-N-methylcarboxamides as A3 adenosine receptor agonists. Bioorg Med Chem. 2010 May 1;18(9):3078-87. | |||||
REF 144 | Isoquinoline and quinazoline urea analogues as antagonists for the human adenosine A(3) receptor. J Med Chem. 2000 Jun 1;43(11):2227-38. | |||||
REF 145 | A novel class of adenosine A3 receptor ligands. 1. 3-(2-Pyridinyl)isoquinoline derivatives. J Med Chem. 1998 Oct 8;41(21):3987-93. | |||||
REF 146 | Characterization of 8-(N-methylisopropyl)amino-N6-(5'-endohydroxy- endonorbornyl)-9-methyladenine (WRC-0571), a highly potent and selective, non-xanthine antagonist of A1 adenosine receptors. J Pharmacol Exp Ther. 1996 Feb;276(2):490-9. | |||||
REF 147 | Inhibition of human mast cell activation with the novel selective adenosine A(2B) receptor antagonist 3-isobutyl-8-pyrrolidinoxanthine (IPDX)(2). Biochem Pharmacol. 2001 Nov 1;62(9):1163-73. | |||||
REF 148 | [3H]HEMADO--a novel tritiated agonist selective for the human adenosine A3 receptor. Eur J Pharmacol. 2007 Feb 5;556(1-3):14-8. | |||||
REF 149 | Adenosine receptor agonists: synthesis and biological evaluation of 1-deaza analogues of adenosine derivatives. J Med Chem. 1988 Jun;31(6):1179-83. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.