Target Information

Target General Information

Target ID

T92030 (Former ID: TTDNC00443)

Target Name

Regenerating human pro-islet peptide (REG3A)

Synonyms

Regenerating islet-derived protein III-alpha; Regenerating islet-derived protein 3-alpha 15 kDa form; Regenerating islet-derived protein 3-alpha; Reg III-alpha; REG3A; REG-3-alpha; Pancreatitis-associated protein 1; Human proislet peptide; Hepatointestinal pancreatic protein; HIP/PAP

Click to Show/Hide

Gene Name

REG3A

Target Type

Clinical trial target

[1]

Disease

[+] 3 Target-related Diseases

Liver disease [ICD-11: DB90-DB9Z]

Type 2 diabetes mellitus [ICD-11: 5A11]

Type-1/2 diabete [ICD-11: 5A10-5A11]

Function

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.

Click to Show/Hide

UniProt ID

REG3A_HUMAN

Sequence

MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKS
WTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGW
EWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

PDB

ADReCS ID

BADD_A03263

HIT2.0 ID

T83QKS

Drugs and Modes of Action

Top

Clinical Trial Drug(s)

[+] 2 Clinical Trial Drugs

ALF-5755

Drug Info

Phase 2

Liver failure

[2]

HIP-2B

Drug Info

Phase 1

Type-1/2 diabetes

[3]

Mode of Action

[+] 1 Modes of Action

Modulator

[+] 2 Modulator drugs

ALF-5755

Drug Info

[1]

HIP-2B

Drug Info

[4]

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues. The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021). Human Similarity Proteins Human Tissue Distribution

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.

The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021).

Human Similarity Proteins

Human Tissue Distribution

There is no similarity protein (E value < 0.005) for this target


Note: If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.

Target Profiles in Patients

Top

Target Expression
Profile (TEP)

Target Expression Profile Info

References

Top

REF 1

HIP/PAP prevents excitotoxic neuronal death and promotes plasticity. Ann Clin Transl Neurol. 2014 October; 1(10): 739-754.

REF 2

ClinicalTrials.gov (NCT01318525) Efficacy & Safety of ALF-5755 in Patients With Nonacetaminophen Severe Acute Hepatitis & Early Stage Acute Liver Failure. U.S. National Institutes of Health.

REF 3

ClinicalTrials.gov (NCT01933256) Study of Subcutaneous Doses of HIP2B in Subjects With Type 2 Diabetes Mellitus Treated With Metformin. U.S. National Institutes of Health.

REF 4

Hepatocarcinoma-intestine-pancreas/pancreatic associated protein (HIP/PAP) is expressed and secreted by proliferating ductules as well as by hepatocarcinoma and cholangiocarcinoma cells. Am J Pathol.1999 Nov;155(5):1525-33.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN