Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T90800
(Former ID: TTDI02634)
|
|||||
Target Name |
Cell surface protein HB15 (CD83)
|
|||||
Synonyms |
hCD83; CD83 antigen; Bcell activation protein; B-cell activation protein
Click to Show/Hide
|
|||||
Gene Name |
CD83
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.
Click to Show/Hide
|
|||||
BioChemical Class |
Immunoglobulin
|
|||||
UniProt ID | ||||||
Sequence |
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERM
ETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSG KVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGM ERAFLPVTSPNKHLGLVTPHKTELV Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T26RYP |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | CD83 is a new potential biomarker and therapeutic target for Hodgkin lymphoma. Haematologica. 2018 Apr;103(4):655-665. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.