Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T89251
|
|||||
Target Name |
Apoptosis regulator BAX (BAX)
|
|||||
Synonyms |
Bcl-2-like protein 4; Bcl2-L-4
|
|||||
Gene Name |
BAX
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Ovarian dysfunction [ICD-11: 5A80] | |||||
Function |
Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV LTASLTIWKKMG Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
ADReCS ID | BADD_A05213 ; BADD_A05519 ; BADD_A05675 ; BADD_A08298 | |||||
HIT2.0 ID | T80TUC |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | Thymoquinone | Drug Info | Phase 2/3 | Polycystic ovarian syndrome | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Inhibitor | [+] 1 Inhibitor drugs | + | ||||
1 | Thymoquinone | Drug Info | [1] |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Apoptosis as a mechanism for the treatment of adult T cell leukemia: promising drugs from benchside to bedside. Drug Discov Today. 2020 Jul;25(7):1189-1197. | |||||
REF 2 | ClinicalTrials.gov (NCT04852510) Amelioration of Polycystic Ovary Syndrome Related Disorders by Supplementation of Thymoquinone and Metformin. U.S. National Institutes of Health. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.