Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T87661
(Former ID: TTDI03235)
|
|||||
| Target Name |
G-protein coupled receptor 174 (GPR174)
|
|||||
| Synonyms |
Probable G-protein coupled receptor 174
Click to Show/Hide
|
|||||
| Gene Name |
GPR174
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Function |
Putative receptor for purines coupled to G-proteins.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MPANYTCTRPDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMIN
LAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFL MYPFRFHDCKQKYDLYISIAGWLIICLACVLFPLLRTSDDTSGNRTKCFVDLPTRNVNLA QSVVMMTIGELIGFVTPLLIVLYCTWKTVLSLQDKYPMAQDLGEKQKALKMILTCAGVFL ICFAPYHFSFPLDFLVKSNEIKSCLARRVILIFHSVALCLASLNSCLDPVIYYFSTNEFR RRLSRQDLHDSIQLHAKSFVSNHTASTMTPELC Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | TGFalpha shedding assay: an accurate and versatile method for detecting GPCR activation. Nat Methods. 2012 Oct;9(10):1021-9. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.