Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T87542
(Former ID: TTDR00166)
|
|||||
| Target Name |
Bacterial Glutamate-1-semialdehyde aminomutase (Bact hemL)
|
|||||
| Synonyms |
Glutamate-1-semialdehyde aminotransferase; Glutamate-1-semialdehyde 2,1-aminomutase; GSA-AT; GSA
Click to Show/Hide
|
|||||
| Gene Name |
Bact hemL
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Function |
Catalyses the formation of this key precursor of tetrapyrroles.
Click to Show/Hide
|
|||||
| BioChemical Class |
Intramolecular transferases
|
|||||
| UniProt ID | ||||||
| Sequence |
MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWG
PMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAQLVTELVPTMDMVRMVNSGTEATM SAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKYTLTCT YNDLASVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVM TGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSG NPIAMAAGFACLNEVAQPGVHETLDELTTRLAEGLLEAAEEAGIPLVVNHVGGMFGIFFT DAESVTCYQDVMACDVERFKRFFHMMLDEGVYLAPSAFEAGFMSVAHSMEDINNTIDAAR RVFAKL Click to Show/Hide
|
|||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| Panther Pathway | [+] 1 Panther Pathways | + | ||||
| 1 | Heme biosynthesis | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Reactions of glutamate 1-semialdehyde aminomutase with R- and S-enantiomers of a novel, mechanism-based inhibitor, 2,3-diaminopropyl sulfate. Biochemistry. 2000 Mar 21;39(11):3091-6. | |||||
| REF 2 | A suicide vector for allelic recombination involving the gene for glutamate 1-semialdehyde aminotransferase in the cyanobacterium Synechococcus PCC 7942. Mol Gen Genet. 1997 Jul;255(4):392-9. | |||||
| REF 3 | Gabaculine-resistant glutamate 1-semialdehyde aminotransferase of Synechococcus. Deletion of a tripeptide close to the NH2 terminus and internal amino acid substitution. J Biol Chem. 1991 Jul 5;266(19):12495-501. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.