Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T86717
(Former ID: TTDR00762)
|
|||||
Target Name |
Bacterial Dehydroquinate synthase (Bact aroB)
|
|||||
Synonyms |
DHQS; 3-dehydroquinate synthase
Click to Show/Hide
|
|||||
Gene Name |
Bact aroB
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
Catalyzes the conversion of 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) to dehydroquinate (DHQ).
Click to Show/Hide
|
|||||
BioChemical Class |
Alpha-carbonic anhydrase
|
|||||
UniProt ID | ||||||
Sequence |
MERIVVTLGERSYPITIASGLFNEPASFLPLKSGEQVMLVTNETLAPLYLDKVRGVLEQA
GVNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQR GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELAS GLAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLR ALLNLGHTFGHAIEAEMGYGNWLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLLKRA GLPVNGPREMSAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRSGVSHELVLNAIADCQ SA Click to Show/Hide
|
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
Panther Pathway | [+] 1 Panther Pathways | + | ||||
1 | Chorismate biosynthesis |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.