Target Information

Target General Information

Target ID

T85651 (Former ID: TTDI02268)

Target Name

Myc messenger RNA (MYC mRNA)

Synonyms

bHLHe39 (mRNA); Transcription factor p64 (mRNA); Proto-oncogene c-Myc (mRNA); Myc proto-oncogene protein (mRNA); Class E basic helix-loop-helix protein 39 (mRNA); C-myc oncogene (mRNA); C-myc (mRNA)

Click to Show/Hide

Gene Name

MYC

Target Type

Clinical trial target

[1]

Disease

[+] 2 Target-related Diseases

Coronary atherosclerosis [ICD-11: BA80]

Solid tumour/cancer [ICD-11: 2A00-2F9Z]

Function

Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'.

Click to Show/Hide

BioChemical Class

mRNA target

UniProt ID

MYC_HUMAN

Sequence

MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL
RKRREQLKHKLEQLRNSCA

Click to Show/Hide

Drugs and Modes of Action

Top

Clinical Trial Drug(s)

[+] 2 Clinical Trial Drugs

AVI-5126

Drug Info

Phase 2

Coronary artery disease

[2]

Resten-NG

Drug Info

Phase 2

Coronary artery disease

[3]

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Target Profiles in Patients

Top

Target Expression
Profile (TEP)

Target Expression Profile Info

Target Affiliated Biological Pathways		Top
KEGG Pathway	[+] 25 KEGG Pathways	+
1	MAPK signaling pathway
2	ErbB signaling pathway
3	Cell cycle
4	PI3K-Akt signaling pathway
5	Wnt signaling pathway
6	TGF-beta signaling pathway
7	Hippo signaling pathway
8	Signaling pathways regulating pluripotency of stem cells
9	Jak-STAT signaling pathway
10	Thyroid hormone signaling pathway
11	Hepatitis B
12	HTLV-I infection
13	Epstein-Barr virus infection
14	Pathways in cancer
15	Transcriptional misregulation in cancer
16	Proteoglycans in cancer
17	MicroRNAs in cancer
18	Colorectal cancer
19	Endometrial cancer
20	Thyroid cancer
21	Bladder cancer
22	Chronic myeloid leukemia
23	Acute myeloid leukemia
24	Small cell lung cancer
25	Central carbon metabolism in cancer
NetPath Pathway	[+] 9 NetPath Pathways	+
1	IL9 Signaling Pathway
2	TCR Signaling Pathway
3	IL2 Signaling Pathway
4	IL4 Signaling Pathway
5	EGFR1 Signaling Pathway
6	TGF_beta_Receptor Signaling Pathway
7	Notch Signaling Pathway
8	Wnt Signaling Pathway
9	TSH Signaling Pathway
Panther Pathway	[+] 6 Panther Pathways	+
1	Interleukin signaling pathway
2	Oxidative stress response
3	PDGF signaling pathway
4	Wnt signaling pathway
5	p53 pathway feedback loops 2
6	CCKR signaling map ST
PID Pathway	[+] 22 PID Pathways	+
1	Regulation of nuclear SMAD2/3 signaling
2	Notch signaling pathway
3	p73 transcription factor network
4	E2F transcription factor network
5	CD40/CD40L signaling
6	Validated targets of C-MYC transcriptional activation
7	Presenilin action in Notch and Wnt signaling
8	LKB1 signaling events
9	Regulation of Telomerase
10	IL2-mediated signaling events
11	C-MYC pathway
12	IL2 signaling events mediated by PI3K
13	Ceramide signaling pathway
14	AP-1 transcription factor network
15	FOXM1 transcription factor network
16	IL6-mediated signaling events
17	PDGFR-beta signaling pathway
18	C-MYB transcription factor network
19	Validated nuclear estrogen receptor alpha network
20	Regulation of nuclear beta catenin signaling and target gene transcription
21	IL2 signaling events mediated by STAT5
22	Validated targets of C-MYC transcriptional repression
Reactome	[+] 8 Reactome Pathways	+
1	NOTCH1 Intracellular Domain Regulates Transcription
2	SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
3	Constitutive Signaling by NOTCH1 PEST Domain Mutants
4	Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
5	Binding of TCF/LEF:CTNNB1 to target gene promoters
6	MAPK6/MAPK4 signaling
7	Cyclin E associated events during G1/S transition
8	Cyclin A:Cdk2-associated events at S phase entry
WikiPathways	[+] 43 WikiPathways	+
1	DNA Damage Response (only ATM dependent)
2	DNA Damage Response
3	ErbB Signaling Pathway
4	Notch Signaling Pathway
5	IL-2 Signaling Pathway
6	G1 to S cell cycle control
7	Wnt Signaling Pathway
8	p38 MAPK Signaling Pathway
9	Wnt Signaling Pathway and Pluripotency
10	MAPK Signaling Pathway
11	TGF beta Signaling Pathway
12	Wnt Signaling Pathway Netpath
13	PPAR Alpha Pathway
14	Ectoderm Differentiation
15	Hair Follicle Development: Organogenesis (Part 2 of 3)
16	Bladder Cancer
17	Mammary gland development pathway - Involution (Stage 4 of 4)
18	Hair Follicle Development: Induction (Part 1 of 3)
19	S Phase
20	Transcriptional activity of SMAD2/SMAD3:SMAD4 heterotrimer
21	Signaling by NOTCH1
22	Structural Pathway of Interleukin 1 (IL-1)
23	Aryl Hydrocarbon Receptor
24	Polycystic Kidney Disease Pathway
25	Apoptosis
26	Retinoblastoma (RB) in Cancer
27	Spinal Cord Injury
28	Integrated Pancreatic Cancer Pathway
29	Gastric cancer network 2
30	B Cell Receptor Signaling Pathway
31	Prostate Cancer
32	Metastatic brain tumor
33	TSLP Signaling Pathway
34	Neural Crest Differentiation
35	IL-7 Signaling Pathway
36	TSH signaling pathway
37	Integrated Breast Cancer Pathway
38	Integrated Cancer pathway
39	Mitotic G1-G1/S phases
40	TP53 Network
41	miRNAs involved in DNA damage response
42	miRNA Regulation of DNA Damage Response
43	IL-5 Signaling Pathway

References

Top

REF 1

Efficacy of a phosphorodiamidate morpholino oligomer antisense compound in the inhibition of corneal transplant rejection in a rat cornea transplant model. J Ocul Pharmacol Ther. 2012 Apr;28(2):194-201.

REF 2

ClinicalTrials.gov (NCT00451256) Safety and Efficacy Study of AVI-5126 When Used on Vein Grafts Before Use in Heart by-Pass Graft Surgery (CABG). U.S. National Institutes of Health.

REF 3

Technology evaluation: AVI-4126, AVI BioPharma. Curr Opin Mol Ther. 2004 Oct;6(5):551-8.

REF 4

Local delivery of c-myc neutrally charged antisense oligonucleotides with transport catheter inhibits myointimal hyperplasia and positively affects vascular remodeling in the rabbit balloon injury model. Catheter Cardiovasc Interv. 2001 Oct;54(2):247-56.

REF 5

Complete vascular healing and sustained suppression of neointimal thickening after local delivery of advanced c-myc antisense at six months follow-up in a rabbit balloon injury model. Cardiovasc Radiat Med. 2002 Jan-Mar;3(1):26-30.

REF 6

Intramural coronary delivery of advanced antisense oligonucleotides reduces neointimal formation in the porcine stent restenosis model. J Am Coll Cardiol. 2002 May 15;39(10):1686-91.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN