Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T85072
(Former ID: TTDI02207)
|
|||||
| Target Name |
Human papillomavirus protein E7 (HPV E7)
|
|||||
| Synonyms |
Protein E7; E7
Click to Show/Hide
|
|||||
| Gene Name |
HPV E7
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Cervical intraepithelial neoplasia [ICD-11: 2E66] | |||||
| 2 | Dysplasia [ICD-11: LB30-LD2F] | |||||
| Function |
E7 protein has both transforming and trans-activating activities. Disrupts the function of host retinoblastoma protein RB1/pRb, which is a key regulator of the cell cycle. Induces the disassembly of the E2F1 transcription factors from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. Interferes with histone deacetylation mediated by HDAC1 and HDAC2, leading to activation of transcription.
Click to Show/Hide
|
|||||
| BioChemical Class |
Papillomaviridae E protein
|
|||||
| UniProt ID | ||||||
| Sequence |
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCK
CDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP Click to Show/Hide
|
|||||
| ADReCS ID | BADD_A01334 | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 5 Clinical Trial Drugs | + | ||||
| 1 | VGX-3100 | Drug Info | Phase 3 | Cervical Intraepithelial neoplasia | [2] | |
| 2 | ADXS-HPV | Drug Info | Phase 2 | Cervical Intraepithelial neoplasia | [3] | |
| 3 | Tipapkinogene sovacivec | Drug Info | Phase 2 | Cervical Intraepithelial neoplasia | [4] | |
| 4 | CIGB-228 | Drug Info | Phase 1 | Human papillomavirus infection | [5] | |
| 5 | KITE-439 | Drug Info | Phase 1 | Cervical cancer | [6] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Modulator | [+] 2 Modulator drugs | + | ||||
| 1 | VGX-3100 | Drug Info | [1] | |||
| 2 | Tipapkinogene sovacivec | Drug Info | [8], [9] | |||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | KITE-439 | Drug Info | [10] | |||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
| REF 2 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 3 | ClinicalTrials.gov (NCT02002182) Window of Opportunity Trial of ADXS 11-001 Vaccination Prior to Robotic Surgery of HPV-Positive Oropharyngeal Cancer. U.S. National Institutes of Health. | |||||
| REF 4 | ClinicalTrials.gov (NCT01022346) A Study of RO5217790 (HPV Targeted Immunotherapy) in Patients With High Grade Cervical Intraepithelial Neoplasia Associated With High Risk HPV Infection. U.S. National Institutes of Health. | |||||
| REF 5 | Safety and Immunogenicity of a Human Papillomavirus Peptide Vaccine (CIGB-228) in Women with High-Grade Cervical Intraepithelial Neoplasia: First-in-Human, Proof-of-Concept Trial. ISRN Obstet Gynecol. 2011; 2011: 292951. | |||||
| REF 6 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 7 | ADXS11-001 immunotherapy targeting HPV-E7: updated survival and safety data from a phase 2 study in Indian women with recurrent/refractory cervical cancer. Journal for ImmunoTherapy of Cancer, 2013, 1(Suppl 1):P231. | |||||
| REF 8 | Immune therapy for human papillomaviruses-related cancers | |||||
| REF 9 | Therapeutic peptides: new arsenal against drug resistant pathogens. Curr Pharm Des. 2014;20(5):771-92. | |||||
| REF 10 | ClinicalTrials.gov (NCT03912831) Safety and Efficacy of KITE-439 in HLA-A*02:01+ Adults With Relapsed/Refractory HPV16+ Cancers. U.S. National Institutes of Health. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.