Target Information

Target General Information

Top

Target ID

T84359 (Former ID: TTDR00972)

Target Name

Streptococcus Cytidylate kinase (Stre-coc cmk)

Synonyms

cmk; TIGR4; MssA protein; Cytidine monophosphate kinase; CMP kinase

Click to Show/Hide

Gene Name

Stre-coc cmk

Target Type

Literature-reported target

[1]

Function

Atp, datp, and gtp are equally effective as phosphate donors. Cmp and dcmp are the best phosphate acceptors.

Click to Show/Hide

BioChemical Class

Kinase

UniProt ID

KCY_STRPN

EC Number

EC 2.7.4.25

Sequence

MKTIQIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMYRAATYMALKNQLGVEEVEALLA
LLDQHPISFGRSETGDQLVFVGDVDITHPIRENEVTNHVSAIAAIPQVREKLVSLQQEIA
QQGGIVMDGRDIGTVVLPQAELKIFLVASVDERAERRYKENIAKGIETDLETLKKEIAAR
DYKDSHRETSPLKQAEDAVYLDTTGLNIQEVVEKIKAEAEKRM

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

PDB

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Similarity Proteins

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Similarity Proteins

Protein Name	Pfam ID	Percentage of Identity (%)	E value
Adenylate kinase 4, mitochondrial (AK4)	PF00406 ; PF05191	42.105 (16/38)	3.00E-03
Adenylate kinase 9 (AK9)	PF00406	47.222 (17/36)	5.00E-03

Drug Property Profile of Target

Top

(1) Molecular Weight (mw) based Drug Clustering

(2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering

(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering

(4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering

(5) Rotatable Bond Count (rotbonds) based Drug Clustering

(6) Topological Polar Surface Area (polararea) based Drug Clustering

"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five

Target Affiliated Biological Pathways

Top

KEGG Pathway

[+] 2 KEGG Pathways

Pyrimidine metabolism

Metabolic pathways

References

Top

REF 1

How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.

REF 2

DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN