Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T82913
(Former ID: TTDR00359)
|
|||||
| Target Name |
Plasmodium Elongation factor 1-alpha 1 (Malaria MEF-1)
|
|||||
| Synonyms |
MEF-1; Elongation factor Tu of Plasmodium falciparum; Elongation factor 1 A-1; EF-Tu; EF-1-alpha-1 of Plasmodium falciparum; EEF1A-1
Click to Show/Hide
|
|||||
| Gene Name |
Malaria MEF-1
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Bacterial infection [ICD-11: 1A00-1C4Z] | |||||
| Function |
This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.
Click to Show/Hide
|
|||||
| BioChemical Class |
Acid anhydrides hydrolase
|
|||||
| UniProt ID | ||||||
| Sequence |
MGKEKTHINLVVIGHVDSGKSTTTGHIIYKLGGIDRRTIEKFEKESAEMGKGSFKYAWVL
DKLKAERERGITIDIALWKFETPRYFFTVIDAPGHKDFIKNMITGTSQADVALLVVPADV GGFDGAFSKEGQTKEHVLLAFTLGVKQIVVGVNKMDTVKYSEDRYEEIKKEVKDYLKKVG YQADKVDFIPISGFEGDNLIEKSDKTPWYKGRTLIEALDTMQPPKRPYDKPLRIPLQGVY KIGGIGTVPVGRVETGILKAGMVLNFAPSAVVSECKSVEMHKEVLEEARPGDNIGFNVKN VSVKEIKRGYVASDTKNEPAKGCSKFTAQVIILNHPGEIKNGYTPLLDCHTSHISCKFLN IDSKIDKRSGKVVEENPKAIKSGDSALVSLEPKKPMVVETFTEYPPLGRFAIRDMRQTIA VGIINQLKRKNLGAVTAKAPAKK Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | Ge2270a | Drug Info | Phase 1 | Bacterial infection | [2] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Inhibitor | [+] 2 Inhibitor drugs | + | ||||
| 1 | Ge2270a | Drug Info | [1] | |||
| 2 | Guanosine-5'-Diphosphate | Drug Info | [1] | |||
| Binder | [+] 1 Binder drugs | + | ||||
| 1 | Amythiamicin | Drug Info | [3] | |||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
| REF 2 | In vitro antimicrobial activity of a new antibiotic, MDL 62,879 (GE2270 A).. Antimicrob Agents Chemother. 1993 April; 37(4): 741-745. | |||||
| REF 3 | The apicoplast as an antimalarial drug target. Drug Resist Updat. 2001 Jun;4(3):145-51. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.