Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T81694
(Former ID: TTDI01604)
|
|||||
Target Name |
Rhinovirus Protein 1 (HRV P1D)
|
|||||
Synonyms |
Rhinovirus Capsid protein VP1; Rhinovirus P1D; Rhinovirus Virion protein 1
Click to Show/Hide
|
|||||
Gene Name |
HRV P1D
|
|||||
Target Type |
Discontinued target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Virus infection [ICD-11: 1A24-1D9Z] | |||||
Function |
Capsid protein VP1: Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome. Capsid protein VP1 mainly forms the vertices of the capsid. Capsid protein VP1 interacts with host cell receptor to provide virion attachment to target host cells. This attachment induces virion internalization. Tyrosine kinases are probably involved in the entry process. After binding to its receptor, the capsid undergoes conformational changes. Capsid protein VP1 N-terminus (that contains an amphipathic alpha-helix) and capsid protein VP4 are externalized. Together, they shape a pore in the host membrane through which viral genome is translocated to host cell cytoplasm. After genome has been released, the channel shrinks (By similarity).
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
PIEQNPVENYIDEVLNEVLVVPNIKESHHTTSNSAPLLDAAETGHTSNVQPEDAIETRYV
MTSQTRDEMSIESFLGRSGCVHISRIKVDYNDYNGVNKNFTTWKITLQEMAQIRRKFELF TYVRFDSEVTLVPCIAGRGDDIGHVVMQYMYVPPGAPIPKTRNDFSWQSGTNMSIFWQHG QPFPRFSLPFLSIASAYYMFYDGYDGDNSSSKYGSIVTNDMGTICSRIVTEKQEHPVVIT THIYHKAKHTKAWCPRPPRAVPYTHSRVTNYVPKTGDVTTAIVPRASMKTV Click to Show/Hide
|
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
1 | R-61837 | Drug Info | Discontinued in Phase 2 | Virus infection | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | R-61837 | Drug Info | [1] |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | In vitro activity of R 61837, a new antirhinovirus compound. Arch Virol. 1988;101(3-4):155-67. | |||||
REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001063) |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.