Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T78393
(Former ID: TTDR01372)
|
|||||
| Target Name |
MIF messenger RNA (MIF mRNA)
|
|||||
| Synonyms |
Phenylpyruvate tautomerase (mRNA); MMIF (mRNA); L-dopachrome tautomerase (mRNA); L-dopachrome isomerase (mRNA); Glycosylation-inhibiting factor (mRNA); GLIF (mRNA); GIF (mRNA)
Click to Show/Hide
|
|||||
| Gene Name |
MIF
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| Function |
Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity. Pro-inflammatory cytokine.
Click to Show/Hide
|
|||||
| BioChemical Class |
mRNA target
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 5.3.2.1
|
|||||
| Sequence |
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA Click to Show/Hide
|
|||||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
| 1 | Tyrosine metabolism | |||||
| 2 | Phenylalanine metabolism | |||||
| Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
| 1 | Tyrosine Metabolism | |||||
| WikiPathways | [+] 2 WikiPathways | + | ||||
| 1 | Spinal Cord Injury | |||||
| 2 | Adipogenesis | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | US patent application no. 6,268,151, Antisense modulation of macrophage migration inhibitory factor expression. | |||||
| REF 2 | An integrative in silico methodology for the identification of modulators of macrophage migration inhibitory factor (MIF) tautomerase activity. Bioorg Med Chem. 2010 Jul 15;18(14):5425-40. | |||||
| REF 3 | Discovery of human macrophage migration inhibitory factor (MIF)-CD74 antagonists via virtual screening. J Med Chem. 2009 Jan 22;52(2):416-24. | |||||
| REF 4 | Classification of chemical compounds by protein-compound docking for use in designing a focused library. J Med Chem. 2006 Jan 26;49(2):523-33. | |||||
| REF 5 | Optimization of N-benzyl-benzoxazol-2-ones as receptor antagonists of macrophage migration inhibitory factor (MIF). Bioorg Med Chem Lett. 2010 Oct 1;20(19):5811-4. | |||||
| REF 6 | Receptor agonists of macrophage migration inhibitory factor. Bioorg Med Chem Lett. 2010 Dec 1;20(23):7033-6. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.