Target Information

Target General Information

Top

Target ID

T72732 (Former ID: TTDI03182)

Target Name

Ephrin type-B receptor 6 (EPHB6)

Synonyms

Tyrosine-protein kinase-defective receptor EPH-6; HEP

Click to Show/Hide

Gene Name

EPHB6

Target Type

Literature-reported target

[1]

Function

Binds to ephrin-B1 and ephrin-B2. Modulates cell adhesion and migration by exerting both positive and negative effects upon stimulation with ephrin-B2. Inhibits JNK activation, T-cell receptor-induced IL-2 secretion and CD25 expression upon stimulation with ephrin-B2. Kinase-defective receptor for members of the ephrin-B family.

Click to Show/Hide

BioChemical Class

Kinase

UniProt ID

EPHB6_HUMAN

Sequence

MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVS
VLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVS
GGTCRETFTLYYRQAEEPDSPDSVSSWHLKRWTKVDTIAADESFPSSSSSSSSSSSAAWA
VGPHGAGQRAGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVRLFSYTCPAVLRSFA
SFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGCR
CQPGYQPARGDKACQACPRGLYKSSAGNAPCSPCPARSHAPNPAAPVCPCLEGFYRASSD
PPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGG
GGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAIN
VSTSHEVPSAVPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTS
ETNTATVTQLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSI
LGALAFLLLAAITVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIRE
LAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVAIQALWAGGAESLQMTFLGRA
AVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVA
AAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTT
SSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQK
DRARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAI
GLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVE
V

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function. Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006). Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database. The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017). Human Similarity Proteins Human Pathway Affiliation Biological Network Descriptors

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.

Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006).

Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.

The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017).

Human Similarity Proteins

Human Pathway Affiliation

Biological Network Descriptors

Protein Name	Pfam ID	Percentage of Identity (%)	E value
Mixed lineage kinase 1 (MAP3K9)	PF00069 ; PF14604	31.250 (90/288)	1.56E-22
Serine/threonine-protein kinase 26 (STK26)	PF00069	29.646 (67/226)	2.85E-16
Serine/threonine-protein kinase 24 (STK24)	PF00069	28.033 (67/239)	1.31E-15
Serine/threonine-protein kinase 33 (STK33)	PF00069	27.027 (60/222)	2.55E-14
Serine/threonine-protein kinase PAK 6 (PAK6)	PF00786 ; PF00069	26.104 (65/249)	4.02E-14
Ribosomal protein S6 kinase alpha-2 (RSK2)	PF00069 ; PF00433	24.681 (58/235)	9.55E-14
Serine/threonine-protein kinase 25 (STK25)	PF00069	28.692 (68/237)	1.13E-13
MST-1 protein kinase (STK4)	PF11629 ; PF00069	24.779 (56/226)	2.13E-13
Ribosomal protein S6 kinase alpha-3 (RSK3)	PF00069 ; PF00433	24.373 (68/279)	2.30E-13
Calcium/calmodulin-dependent protein kinase type 1 (CAMK1)	PF00069	24.775 (55/222)	3.64E-13
Ribosomal protein S6 kinase alpha-6 (RSK6)	PF00069 ; PF00433	25.974 (60/231)	4.04E-13
Protein kinase C delta (PRKCD)	PF00130 ; PF00069 ; PF00433 More >>	25.943 (55/212)	5.38E-13
NUAK family SNF1-like kinase 2 (NUAK2)	PF00069	25.630 (61/238)	5.80E-13
Serine/threonine-protein kinase ULK2 (ULK2)	PF12063 ; PF00069	25.664 (58/226)	6.99E-13
Aurora kinase A (AURKA)	PF00069	25.926 (56/216)	8.13E-13
Serine/threonine-protein kinase 3 (STK3)	PF11629 ; PF00069	24.779 (56/226)	8.92E-13
Omphalocele kinase 1 (NUAK1)	PF00069	23.529 (56/238)	1.23E-12
Serine/threonine-protein kinase MARK1 (MARK1)	PF02149 ; PF00069 ; PF00627 More >>	25.778 (58/225)	1.68E-12
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2)	PF16579 ; PF00069	25.743 (52/202)	2.36E-12
Ribosomal protein S6 kinase alpha-1 (RSK1)	PF00069 ; PF00433	23.789 (54/227)	3.96E-12
5'-AMP-activated protein kinase catalytic subunit alpha-1 (PRKAA1)	PF16579 ; PF00069	25.248 (51/202)	4.54E-12
cAMP-dependent protein kinase catalytic subunit PRKX (PRKX)	PF00069	27.919 (55/197)	5.34E-12
Serine/threonine-protein kinase MARK2 (MARK2)	PF02149 ; PF00069 ; PF00627 More >>	25.333 (57/225)	7.07E-12
Calcium/calmodulin-dependent protein kinase type 1G (CAMK1G)	PF00069	23.265 (57/245)	7.21E-12
Microtubule affinity regulating kinase 3 (MARK3)	PF02149 ; PF00069 ; PF00627 More >>	24.889 (56/225)	1.05E-11
BR serine/threonine kinase 1 (BRSK1)	PF00069	25.764 (59/229)	1.11E-11
Serine/threonine-protein kinase Sgk3 (SGK3)	PF00069 ; PF00433 ; PF00787 More >>	24.149 (78/323)	1.30E-11
BR serine/threonine kinase 2 (BRSK2)	PF00069	25.610 (63/246)	2.15E-11
Polo-like kinase 4 (PLK4)	PF00069 ; PF18190 ; PF18409 More >>	23.041 (50/217)	2.51E-11
MAP/microtubule affinity-regulating kinase 4 (MARK4)	PF02149 ; PF00069 ; PF00627 More >>	24.444 (55/225)	2.54E-11
Unc-51 like kinase 3 (ULK3)	PF04212 ; PF00069	25.097 (65/259)	2.61E-11
Serine/threonine-protein kinase PAK 5 (PAK5)	PF00786 ; PF00069	25.862 (60/232)	2.84E-11
Aurora kinase C (AURKC)	PF00069	25.000 (54/216)	4.74E-11
Inhibitor of nuclear factor kappa-B kinase beta (IKKB)	PF18397 ; PF12179 ; PF00069 More >>	24.885 (54/217)	5.01E-11
Fused homolog (STK36)	PF13646 ; PF00069	23.148 (50/216)	6.31E-11
Receptor-interacting serine/threonine-protein kinase 3 (RIPK3)	PF00069 ; PF12721	27.660 (78/282)	6.43E-11
Protein kinase C theta (PRKCQ)	PF00130 ; PF00069 ; PF00433 More >>	24.444 (55/225)	6.83E-11
Putative serine/threonine-protein kinase PRKY (PRKY)	PF00069	31.169 (48/154)	8.29E-11
Leucine-rich repeat kinase 2 (LRRK2)	PF16095 ; PF12799 ; PF13855 ; PF00069 ; PF08477 More >>	24.207 (84/347)	1.12E-10
PAK-4 protein kinase (PAK4)	PF00786 ; PF00069	25.214 (59/234)	1.34E-10
Calcium/calmodulin-dependent protein kinase type 1D (CAMK1D)	PF00069	22.000 (55/250)	1.35E-10
MEK kinase kinase 1 (MAP4K1)	PF00780 ; PF00069	26.941 (59/219)	1.52E-10
SIK family kinase 3 (SIK3)	PF00069	25.818 (71/275)	2.19E-10
TRAF2 and NCK interacting kinase (TNIK)	PF00780 ; PF00069	26.906 (60/223)	3.32E-10
Aurora kinase B (AURKB)	PF00069	24.519 (51/208)	3.57E-10
STE20-related serine/threonine-protein kinase (SLK)	PF00069 ; PF12474	25.217 (58/230)	4.07E-10
STE20-related kinase adapter protein alpha (STRADA)	PF00069	26.027 (57/219)	4.35E-10
ERK activator kinase 5 (MAP2K5)	PF00564 ; PF00069	24.500 (49/200)	4.39E-10
Protein kinase C epsilon (PRKCE)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	22.172 (49/221)	5.13E-10
Misshapen-like kinase 1 (MINK1)	PF00780 ; PF00069	27.386 (66/241)	5.73E-10
Serine/threonine-protein kinase NIM1 (NIM1K)	PF00069	23.529 (56/238)	5.80E-10
STE20-related kinase adapter protein beta (STRADB)	PF00069	25.660 (68/265)	7.55E-10
Serine/threonine-protein kinase Sgk1 (SGK1)	PF00069 ; PF00433	25.000 (62/248)	9.15E-10
Protein kinase C alpha (PRKCA)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	24.809 (65/262)	1.08E-09
Serine/threonine-protein kinase ULK1 (ULK1)	PF12063 ; PF00069	24.017 (55/229)	1.19E-09
Cyclin-dependent kinase 3 (CDK3)	PF00069	25.641 (50/195)	1.30E-09
cAMP-dependent protein kinase catalytic subunit beta (PRKACB)	PF00069	25.628 (51/199)	1.30E-09
Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform (PHKG1)	PF00069	23.767 (53/223)	1.40E-09
MAPK-activated protein kinase 3 (MAPKAPK3)	PF00069	27.152 (41/151)	1.59E-09
MEK kinase kinase 4 (MAP4K4)	PF00780 ; PF00069	27.459 (67/244)	1.60E-09
Salt-inducible kinase 2 (SIK2)	PF00069	25.000 (57/228)	1.76E-09
Cyclin-dependent kinase 1 (CDK1)	PF00069	25.000 (58/232)	1.98E-09
cAMP-dependent protein kinase catalytic subunit gamma (PRKACG)	PF00069	26.020 (51/196)	2.23E-09
Salt-inducible kinase 1 (SIK1)	PF00069	25.778 (58/225)	2.74E-09
Calcium/calmodulin-dependent protein kinase type 1B (PNCK)	PF00069	24.670 (56/227)	2.78E-09
Putative serine/threonine-protein kinase SIK1B (SIK1B)	PF00069	25.778 (58/225)	2.84E-09
Ribosomal protein S6 kinase alpha-5 (RSK5)	PF00069 ; PF00433	25.170 (37/147)	2.89E-09
Serine/threonine-protein kinase Nek4 (NEK4)	PF00069	26.122 (64/245)	3.59E-09
CaM kinase-like vesicle-associated protein (CAMKV)	PF00069	25.743 (52/202)	4.37E-09
Extracellular signal-regulated kinase 1 (ERK1)	PF00069	23.853 (52/218)	4.86E-09
Protein kinase C beta (PRKCB)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	23.585 (50/212)	4.98E-09
SNF-related serine/threonine-protein kinase (SNRK)	PF00069	22.222 (56/252)	6.05E-09
PAK-2 protein kinase (PAK2)	PF00786 ; PF00069	25.221 (57/226)	6.53E-09
Protein kinase G1 (PRKG1)	PF00027 ; PF16808 ; PF00069 More >>	25.888 (51/197)	7.08E-09
Apoptosis signal-regulating kinase 1 (MAP3K5)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	23.125 (74/320)	7.46E-09
Cyclin-dependent kinase-like 3 (CDKL3)	PF00069	25.381 (50/197)	7.53E-09
Maternal embryonic leucine zipper kinase (MELK)	PF02149 ; PF00069	24.314 (62/255)	7.98E-09
Ste-20-related kinase (STK39)	PF12202 ; PF00069	22.373 (66/295)	8.72E-09
cAMP-dependent protein kinase catalytic subunit alpha (PRKACA)	PF00069	23.469 (46/196)	8.82E-09
RAC-gamma serine/threonine-protein kinase (AKT3)	PF00169 ; PF00069 ; PF00433 More >>	22.624 (50/221)	1.09E-08
Serine/threonine-protein kinase ICK (CILK1)	PF00069	24.229 (55/227)	1.33E-08
Oxidative stress responsive 1 (OXSR1)	PF12202 ; PF00069	22.034 (65/295)	1.50E-08
Serine/threonine-protein kinase H1 (PSKH1)	PF00069	24.434 (54/221)	1.51E-08
Mitogen-activated protein kinase kinase kinase 15 (MAP3K15)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	22.420 (63/281)	1.61E-08
Doublecortin-like kinase 2 (DCLK2)	PF03607 ; PF00069	23.590 (46/195)	1.95E-08
Serine/threonine-protein kinase Nek11 (NEK11)	PF00069	22.222 (44/198)	2.39E-08
Myosin light chain kinase 2 (MYLK2)	PF00069	21.127 (45/213)	2.45E-08
Serine/threonine-protein kinase Sgk2 (SGK2)	PF00069 ; PF00433	21.778 (49/225)	2.47E-08
Protein kinase C eta type (PRKCH)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	21.531 (45/209)	2.49E-08
TBC domain-containing protein kinase-like protein (TBCK)	PF00069 ; PF00566 ; PF00581 More >>	27.778 (50/180)	2.49E-08
MEK kinase kinase 3 (MAP4K3)	PF00780 ; PF00069	23.404 (55/235)	2.83E-08
Serine/threonine-protein kinase D2 (PRKD2)	PF00130 ; PF00069	25.333 (57/225)	2.86E-08
Serine/threonine-protein kinase Nek5 (NEK5)	PF00069	20.076 (53/264)	2.98E-08
Cyclin-dependent kinase 6 (CDK6)	PF00069	27.411 (54/197)	3.11E-08
RAC-beta serine/threonine-protein kinase (AKT2)	PF00169 ; PF00069 ; PF00433 More >>	22.449 (55/245)	3.59E-08
Serine/threonine-protein kinase WNK1 (WNK1)	PF12202 ; PF00069	23.982 (53/221)	3.81E-08
Inhibitor of nuclear factor kappa-B kinase alpha (IKKA)	PF18397 ; PF12179 ; PF00069 More >>	21.801 (46/211)	4.83E-08
Protein kinase N1 (PKN1)	PF02185 ; PF00069 ; PF00433 More >>	27.193 (62/228)	5.23E-08
Serine/threonine-protein kinase Nek8 (NEK8)	PF00069 ; PF00415	22.093 (57/258)	5.31E-08
MAPK/ERK kinase kinase 3 (MAP3K3)	PF00564 ; PF00069	25.764 (59/229)	5.45E-08
Protein kinase D (PRKD1)	PF00130 ; PF00169 ; PF00069 More >>	23.661 (53/224)	7.02E-08
Myosin-IIIb (MYO3B)	PF00612 ; PF00063 ; PF00069 More >>	25.461 (69/271)	7.06E-08
Serine/threonine-protein kinase PAK 3 (PAK3)	PF00786 ; PF00069	25.221 (57/226)	8.16E-08
PAK-1 protein kinase (PAK1)	PF00786 ; PF00069	24.554 (55/224)	8.37E-08
Ribosomal protein S6 kinase beta-1 (S6K1)	PF00069 ; PF00433	21.795 (51/234)	9.12E-08
TGF-beta-stimulated factor 1 (STK16)	PF00069	23.214 (52/224)	1.12E-07
MAPK-activated protein kinase 2 (MAPKAPK2)	PF00069	25.121 (52/207)	1.12E-07
NIMA-related kinase 6 (NEK6)	PF00069	23.282 (61/262)	1.16E-07
Serine/threonine-protein kinase D3 (PRKD3)	PF00130 ; PF00169 ; PF00069 More >>	25.185 (68/270)	1.42E-07
Cyclin-dependent kinase 13 (CDK13)	PF12330 ; PF00069	20.548 (45/219)	1.51E-07
Doublecortin-like kinase 1 (DCLK1)	PF03607 ; PF00069	23.077 (45/195)	1.54E-07
Serine/threonine-protein kinase Nek3 (NEK3)	PF00069	19.679 (49/249)	1.78E-07
Hormonally up-regulated neu tumor-associated kinase (HUNK)	PF00069	22.530 (57/253)	1.99E-07
Ribosomal protein S6 kinase beta-2 (RPS6KB2)	PF00069 ; PF00433	22.134 (56/253)	2.08E-07
Protein kinase C iota (PRKCI)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	22.886 (46/201)	2.16E-07
Serine/threonine-protein kinase MAK (MAK)	PF00069	22.907 (52/227)	2.43E-07
Death-associated protein kinase 1 (DAPK1)	PF00023 ; PF12796 ; PF13637 ; PF00531 ; PF00069 More >>	21.121 (49/232)	2.87E-07
Activin receptor type IB (ACVR1B)	PF01064 ; PF00069 ; PF08515 More >>	24.424 (53/217)	4.00E-07
Cyclin-dependent kinase 4 (CDK4)	PF00069	25.210 (60/238)	4.36E-07
NIMA-related kinase 7 (NEK7)	PF00069	23.207 (55/237)	4.96E-07
Protein kinase G2 (PRKG2)	PF00027 ; PF00069	23.005 (49/213)	5.73E-07
Myosin light chain kinase family member 4 (MYLK4)	PF00069	19.905 (42/211)	6.06E-07
Protein kinase C gamma (PRKCG)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	22.273 (49/220)	6.34E-07
Myosin light chain kinase 3 (MYLK3)	PF00069	22.170 (47/212)	6.51E-07
Putative 3-phosphoinositide-dependent protein kinase 2 (PDPK2P)	PF00069	20.089 (45/224)	6.65E-07
Apoptosis signal-regulating kinase 2 (MAP3K6)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	24.290 (77/317)	8.03E-07
Serine/threonine-protein kinase Chk2 (RAD53)	PF00498 ; PF00069	24.155 (50/207)	8.49E-07
Peripheral plasma membrane protein CASK (CASK)	PF00625 ; PF02828 ; PF00595 ; PF00069 ; PF00018 More >>	23.556 (53/225)	8.66E-07
Extracellular signal-regulated kinase 2 (ERK2)	PF00069	22.124 (50/226)	8.67E-07
Serine/threonine-protein kinase WNK4 (WNK4)	PF12202 ; PF00069	26.549 (60/226)	8.76E-07
TGF-beta receptor type I (TGFBR1)	PF01064 ; PF00069 ; PF08515 More >>	23.735 (61/257)	9.12E-07
SPS1/STE20-related protein kinase YSK4 (YSK4)	PF00069	23.348 (53/227)	9.41E-07
Serine/threonine-protein kinase Nek9 (NEK9)	PF00069 ; PF00415	21.639 (66/305)	9.41E-07
Cyclin-dependent kinase 10 (CDK10)	PF00069	26.000 (52/200)	9.47E-07
Cyclin-dependent kinase 19 (CDK19)	PF00069	23.188 (48/207)	9.76E-07
Mitogen-activated protein kinase 13 (MAPK13)	PF00069	25.116 (54/215)	1.42E-06
IL-1 receptor-associated kinase 3 (IRAK3)	PF00531 ; PF00069	24.880 (52/209)	1.58E-06
Cyclin-dependent kinase 7 (CDK7)	PF00069	21.939 (43/196)	1.74E-06
Serine/threonine-protein kinase 17B (STK17B)	PF00069	22.624 (50/221)	1.98E-06
Phosphoinositide dependent protein kinase-1 (PDPK1)	PF14593 ; PF00069	20.089 (45/224)	2.05E-06
Cyclin-dependent kinase-like 2 (CDKL2)	PF00069	25.126 (50/199)	2.26E-06
Cyclin-dependent kinase 2 (CDK2)	PF00069	24.500 (49/200)	2.29E-06
MAPK/ERK kinase kinase 2 (MAP3K2)	PF00564 ; PF00069	22.348 (59/264)	2.42E-06
Mitogen-activated protein kinase kinase kinase kinase 5 (MAP4K5)	PF00780 ; PF00069	23.982 (53/221)	3.20E-06
Cyclin-dependent kinase 12 (CDK12)	PF00069	20.290 (42/207)	3.44E-06
WNK lysine-deficient protein kinase 3 (WNK3)	PF12202 ; PF00069	23.697 (50/211)	4.08E-06
RAC-alpha serine/threonine-protein kinase (AKT1)	PF00169 ; PF00069 ; PF00433 More >>	22.984 (57/248)	4.46E-06
Leucine-rich repeat serine/threonine-protein kinase 1 (LRRK1)	PF12796 ; PF16095 ; PF00069 ; PF08477 More >>	24.413 (52/213)	4.73E-06
Polo-like kinase 2 (PLK2)	PF00069 ; PF00659	19.388 (38/196)	5.27E-06
IL-1 receptor-associated kinase 1 (IRAK1)	PF00531 ; PF00069	24.299 (52/214)	5.35E-06
G protein-coupled receptor kinase 6 (GRK6)	PF00069 ; PF00615	23.232 (46/198)	5.36E-06
Death-associated protein kinase 3 (DAPK3)	PF00069	21.088 (62/294)	5.42E-06
Cytoplasmic DRAK1 (STK17A)	PF00069	23.364 (50/214)	6.25E-06
Protein kinase C zeta (PRKCZ)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	20.000 (43/215)	6.67E-06
Myosin-IIIa (MYO3A)	PF00612 ; PF00063 ; PF00069 More >>	24.074 (65/270)	6.97E-06
Triple functional domain protein (TRIO)	PF00650 ; PF07679 ; PF00169 ; PF00069 ; PF00621 ; PF16609 ; PF00018 ; PF00435 More >>	25.000 (64/256)	7.11E-06
Protein kinase N3 (PKN3)	PF02185 ; PF00069 ; PF00433 More >>	24.171 (51/211)	1.07E-05
Serine/threonine-protein kinase WNK2 (WNK2)	PF12202 ; PF00069	22.609 (52/230)	1.09E-05
MAPK/ERK kinase kinase 1 (MAP3K1)	PF00069	22.167 (45/203)	1.24E-05
G protein-coupled receptor kinase 4 (GRK4)	PF00069 ; PF00615	22.831 (50/219)	1.37E-05
PKC-delta-interacting protein kinase (RIPK4)	PF12796 ; PF00069	24.373 (68/279)	1.46E-05
Serine/threonine-protein kinase Nek10 (NEK10)	PF00069	21.839 (38/174)	1.67E-05
Extracellular signal-regulated kinase 5 (ERK5)	PF00069	26.415 (56/212)	1.68E-05
Doublecortin-like kinase 3 (DCLK3)	PF00069	20.179 (45/223)	1.81E-05
NIMA-related kinase 2 (NEK2)	PF00069	23.684 (54/228)	2.14E-05
Serine/threonine-protein kinase pim-2 (PIM2)	PF00069	25.362 (70/276)	2.41E-05
NIMA-related kinase 1 (NEK1)	PF00069	19.898 (39/196)	2.71E-05
Glycogen synthase kinase-3 alpha (GSK-3A)	PF00069	26.415 (56/212)	3.11E-05
Protein kinase N2 (PKN2)	PF02185 ; PF00069 ; PF00433 More >>	25.561 (57/223)	3.17E-05
Cyclin-dependent kinase 15 (CDK15)	PF00069	20.707 (41/198)	3.22E-05
Calcium/calmodulin-dependent protein kinase type IV (CAMK4)	PF00069	22.222 (46/207)	3.84E-05
Serine/threonine-protein kinase H2 (PSKH2)	PF00069	23.246 (53/228)	4.52E-05
Ribosomal protein S6 kinase alpha-4 (RPS6KA4)	PF00069 ; PF00433	26.540 (56/211)	4.86E-05
Dual-specificity tyrosine-phosphorylation regulated kinase 3 (DYRK3)	PF00069	22.709 (57/251)	6.26E-05
ERK activator kinase 1 (MEK1)	PF00069	23.529 (48/204)	8.52E-05
Serine/threonine-protein kinase PLK3 (PLK3)	PF00069 ; PF00659	22.727 (45/198)	9.38E-05
Tyrosine-protein kinase EIF2AK2 (p68)	PF00035 ; PF00069	18.750 (45/240)	1.31E-04
Testis-specific serine/threonine-protein kinase 6 (TSSK6)	PF00069	25.962 (54/208)	1.41E-04
Cyclin-dependent kinase 11A (CDK11A)	PF00069	23.214 (52/224)	1.43E-04
Titin (TTN)		25.301 (42/166)	1.50E-04
Dual specificity mitogen-activated protein kinase kinase 4 (MAP2K4)	PF00069	21.509 (57/265)	1.59E-04
Polo-like kinase 1 (PLK1)	PF00069 ; PF00659	24.658 (36/146)	1.62E-04
Rho-associated protein kinase 1 (ROCK1)	PF00069 ; PF08912	21.457 (53/247)	1.71E-04
Cyclin-dependent kinase 9 (CDK9)	PF00069	26.174 (39/149)	1.98E-04
Anti-mullerian hormone II receptor (AMHR2)	PF00069	27.155 (63/232)	2.09E-04
Calcium/calmodulin-dependent protein kinase type II subunit gamma (CAMK2G)	PF08332 ; PF00069	19.383 (44/227)	2.49E-04
Calcium/calmodulin-dependent protein kinase type II subunit delta (CAMK2D)	PF08332 ; PF00069	20.444 (46/225)	3.31E-04
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A)	PF08332 ; PF00069	20.889 (47/225)	3.40E-04
Calmodulin-dependent kinase II (CAMKK2)	PF00069	23.313 (38/163)	3.46E-04
Endoplasmic reticulum to nucleus signaling 1 (ERN1)	PF00069 ; PF06479	23.718 (37/156)	3.67E-04
CaM-kinase IV kinase (CAMKK1)	PF00069	25.424 (45/177)	4.26E-04
Cyclin-dependent kinase 11B (CDK11B)	PF00069	23.737 (47/198)	4.33E-04
Serine/threonine-protein kinase ULK4 (ULK4)	PF00069	39.655 (23/58)	4.75E-04
Serine/threonine-protein kinase cot (COT)	PF00069	22.843 (45/197)	4.87E-04
Death-associated protein kinase 2 (DAPK2)	PF00069	20.455 (45/220)	4.90E-04
CDC42 binding protein kinase alpha (DMPK-like alpha)	PF00130 ; PF00780 ; PF08826 ; PF15796 ; PF00069 ; PF00433 More >>	21.429 (51/238)	5.24E-04
Proto-oncogene serine/threonine-protein kinase mos (MOS)	PF00069	27.869 (34/122)	5.34E-04
Ribosomal protein S6 kinase-related protein (RSKR)	PF00069	25.773 (25/97)	6.65E-04
Stress-activated protein kinase JNK3 (JNK3)	PF00069	21.973 (49/223)	6.67E-04
Stress-activated protein kinase JNK1 (JNK1)	PF00069	24.294 (43/177)	6.88E-04
Interleukin-1 receptor-associated kinase-like 2 (IRAK2)	PF00531 ; PF00069	24.242 (48/198)	7.25E-04
Serine/threonine-protein kinase MRCK beta (CDC42BPB)	PF00130 ; PF00780 ; PF08826 ; PF15796 ; PF00069 More >>	22.458 (53/236)	7.85E-04
ERK activator kinase 2 (MEK2)	PF00069	23.529 (48/204)	8.71E-04
Citron Rho-interacting kinase (CIT)	PF00780 ; PF00169 ; PF00069 More >>	21.705 (56/258)	1.00E-03
Serine/threonine-protein kinase tousled-like 2 (TLK2)	PF00069	22.167 (45/203)	1.00E-03
Beta-adrenergic receptor kinase 2 (ADRBK2)	PF00169 ; PF00069 ; PF00615 More >>	19.512 (48/246)	1.00E-03
Dual-specificity tyrosine-phosphorylation regulated kinase 1B (DYRK1B)	PF00069	22.469 (91/405)	1.00E-03
Yet another novel kinase 2 (STK32B)	PF00069	23.504 (55/234)	1.00E-03
Serine/threonine-protein kinase PDIK1L (PDIK1L)	PF00069	21.176 (54/255)	1.00E-03
Caskin-1 (CASKIN1)	PF12796 ; PF13637 ; PF16907 ; PF16632 ; PF16600 ; PF00536 ; PF07653 More >>	37.500 (21/56)	1.00E-03
Serine/threonine-protein kinase MRCK gamma (CDC42BPG)	PF00130 ; PF00780 ; PF08826 ; PF00069 More >>	23.256 (60/258)	2.00E-03
Stress-activated protein kinase JNK2 (JNK2)	PF00069	24.000 (36/150)	2.00E-03
Beta-adrenergic receptor kinase 1 (ADRBK1)	PF00169 ; PF00069 ; PF00615 More >>	19.931 (58/291)	2.00E-03
Calcium/calmodulin-dependent protein kinase type II subunit beta (CAMK2B)	PF08332 ; PF00069	20.000 (46/230)	2.00E-03
Microtubule-associated serine/threonine-protein kinase 1 (MAST1)	PF08926 ; PF17820 ; PF00069 More >>	21.834 (50/229)	3.00E-03
Caskin-2 (CASKIN2)	PF12796 ; PF13637 ; PF16907 ; PF16632 ; PF16600 ; PF00536 ; PF07653 More >>	35.593 (21/59)	3.00E-03
Striated muscle preferentially expressed protein kinase (SPEG)	PF07679 ; PF00069 ; PF16650 More >>	23.041 (50/217)	3.00E-03
Dual specificity mitogen-activated protein kinase kinase 6 (MAP2K6)	PF00069	23.276 (54/232)	3.00E-03
Cyclin-dependent kinase 8 (CDK8)	PF00069	22.222 (46/207)	4.00E-03
Membrane-associated kinase (PKMYT1)	PF00069	26.238 (53/202)	5.00E-03
Click to Show/Hide the Information of Human Similarity Proteins

KEGG Pathway	Pathway ID	Affiliated Target	Pathway Map
Axon guidance	hsa04360	Affiliated Target
Class: Organismal Systems => Development and regeneration	Pathway Hierarchy

Degree	2	Degree centrality	2.15E-04	Betweenness centrality	2.50E-08
Closeness centrality	1.82E-01	Radiality	1.30E+01	Clustering coefficient	0.00E+00
Neighborhood connectivity	1.25E+01	Topological coefficient	7.67E-01	Eccentricity	13
Download	Click to Download the Full PPI Network of This Target

Chemical Structure based Activity Landscape of Target

Top

References

Top

REF 1

Amino acid conjugates of lithocholic acid as antagonists of the EphA2 receptor. J Med Chem. 2013 Apr 11;56(7):2936-47.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN