Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T71011
(Former ID: TTDI02345)
|
|||||
| Target Name |
Enterobacteria Shiga-like toxin 2B (EntBac stxB2)
|
|||||
| Synonyms |
stxB2; Verotoxin 2 subunit B; Verocytotoxin 2 subunit B; Shiga-like toxin 2 subunit B; SLT-IIb; SLT-2b; SLT-2 B subunit
Click to Show/Hide
|
|||||
| Gene Name |
EntBac stxB2
|
|||||
| Target Type |
Discontinued target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Escherichia coli intestinal infection [ICD-11: 1A03] | |||||
| Function |
TheB subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
Click to Show/Hide
|
|||||
| BioChemical Class |
Shiga-like toxin beta
|
|||||
| UniProt ID | ||||||
| Sequence |
MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | Urtoxazumab | Drug Info | Discontinued in Phase 2 | Escherichia coli infection | [2] | |
| Drug Binding Sites of Target | Top | |||||
|---|---|---|---|---|---|---|
| Ligand Name: 3-(Pyridin-1-ium-1-yl)propane-1-sulfonate | Ligand Info | |||||
| Structure Description | Shiga toxin type 2 | PDB:1R4P | ||||
| Method | X-ray diffraction | Resolution | 1.77 Å | Mutation | No | [3] |
| PDB Sequence |
ADCAKGKIEF
10 SKYNEDDTFT20 VKVDGKEYWT30 SRWNLQPLLQ40 SAQLTGMTVT50 IKSSTCESGS 60 GFAEVQFNND70
|
|||||
|
|
||||||
| Click to View More Binding Site Information of This Target and Ligand Pair | ||||||
| Click to View More Binding Site Information of This Target with Different Ligands | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Safety and pharmacokinetics of urtoxazumab, a humanized monoclonal antibody, against Shiga-like toxin 2 in healthy adults and in pediatric patients infected with Shiga-like toxin-producing Escherichia coli. Antimicrob Agents Chemother. 2010 Jan;54(1):239-43. | |||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021716) | |||||
| REF 3 | Structure of shiga toxin type 2 (Stx2) from Escherichia coli O157:H7. J Biol Chem. 2004 Jun 25;279(26):27511-7. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.