Target Information

Target General Information

Target ID

T61547 (Former ID: TTDI01711)

Target Name

Staphylococcus Manganese transporter C (Stap-coc MntC)

Synonyms

Metal ABC transporter substrate-binding protein; Manganese ABC transporter substrate-binding protein; Manganese ABC transporter substrate-binding lipoprotein; ABC transporter substrate-binding protein; ABC superfamily ATP binding cassette transporter, binding protein

Click to Show/Hide

Gene Name

Stap-coc MntC

Target Type

Clinical trial target

[1]

Disease

[+] 2 Target-related Diseases

Depression [ICD-11: 6A70-6A7Z]

Staphylococcal/streptococcal disease [ICD-11: 1B5Y]

Function

A component of Mnt comples, conserved across the staphylococcal species group. Expressed on the cell surface of S. aureus in biofilms generated in in vivo models of infection.

Click to Show/Hide

UniProt ID

W8TNQ9_STAAU

Sequence

MKKLVPLLLALLLLVAACGTGGKQSSDKSNGKLKVVTTNSILYDMAKNVGGDNVDIHSIV
PVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSK
DVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQ
LEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQA
IEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMMKSN
IETVHGSMK

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

PDB

Drugs and Modes of Action

Top

Clinical Trial Drug(s)

[+] 1 Clinical Trial Drugs

PF-06290510

Drug Info

Phase 2

Staphylococcus infection

[2]

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Similarity Proteins

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Similarity Proteins

There is no similarity protein (E value < 0.005) for this target

References

Top

REF 1

ClinicalTrials.gov (NCT01364571) Evaluation of a Single Vaccination With One of Three Ascending Dose Levels of a 4-Antigen Staphylococcus Aureus Vaccine (SA4Ag) in Healthy Adults Aged 18 to <65 Years. U.S. National Institutes of Health.

REF 2

Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035724)

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN