Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T58992
(Former ID: TTDS00128)
|
|||||
Target Name |
Opioid receptor delta (OPRD1)
|
|||||
Synonyms |
OPRD; Delta-type opioid receptor; Delta opioid receptor; DOR-1; D-OR-1
|
|||||
Gene Name |
OPRD1
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 3 Target-related Diseases | + | ||||
1 | Bowel habit change [ICD-11: ME05] | |||||
2 | Irritable bowel syndrome [ICD-11: DD91] | |||||
3 | Pain [ICD-11: MG30-MG3Z] | |||||
Function |
Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain and in opiate-mediated analgesia. Plays a role in developing analgesic tolerance to morphine. G-protein coupled receptor that functions as receptor for endogenous enkephalins and for a subset of other opioids.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC TPSDGPGGGAAA Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A03957 ; BADD_A05962 | |||||
HIT2.0 ID | T42O1D |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 6 Approved Drugs | + | ||||
1 | Butorphanol | Drug Info | Approved | Pain | [2], [3] | |
2 | Codeine | Drug Info | Approved | Pain | [4], [5] | |
3 | Eluxadoline | Drug Info | Approved | Diarrhea-predominant irritable bowel syndrome | [6], [7] | |
4 | Hydromorphone | Drug Info | Approved | Pain | [8] | |
5 | Loperamide | Drug Info | Approved | Diarrhea | [8] | |
6 | Oxycodone | Drug Info | Approved | Pain | [9], [10] | |
Clinical Trial Drug(s) | [+] 10 Clinical Trial Drugs | + | ||||
1 | ADL-5747 | Drug Info | Phase 2 | Pain | [11] | |
2 | ADL-5859 | Drug Info | Phase 2 | Rheumatoid arthritis | [12] | |
3 | AZD-2327 | Drug Info | Phase 2 | Anxiety disorder | [13] | |
4 | Met-enkephalin | Drug Info | Phase 2 | Pain | [14], [15] | |
5 | TPM-1/Morphine | Drug Info | Phase 2 | Pain | [16] | |
6 | AIKO-150 | Drug Info | Phase 1 | Opioid dependence | [17] | |
7 | MCP-201 | Drug Info | Phase 1 | Pain | [18] | |
8 | MCP-202 | Drug Info | Phase 1 | Overactive bladder | [19] | |
9 | SALVINORIN A | Drug Info | Phase 1 | Cerebral vasospasm | [20], [21] | |
10 | TRV250 | Drug Info | Phase 1 | Migraine | [21] | |
Discontinued Drug(s) | [+] 4 Discontinued Drugs | + | ||||
1 | DPI-3290 | Drug Info | Discontinued in Phase 2 | Pain | [22] | |
2 | TRK-851 | Drug Info | Discontinued in Phase 1 | Cough | [23] | |
3 | VP004 | Drug Info | Discontinued in Phase 1 | Substance use disorder | [24] | |
4 | SB-219825 | Drug Info | Terminated | Pain | [28] | |
Preclinical Drug(s) | [+] 3 Preclinical Drugs | + | ||||
1 | BIO-306 | Drug Info | Preclinical | Migraine | [25] | |
2 | LY-25582 | Drug Info | Preclinical | Obesity | [26] | |
3 | SoRI-9409 | Drug Info | Preclinical | Alcohol dependence | [27] | |
Mode of Action | [+] 5 Modes of Action | + | ||||
Agonist | [+] 38 Agonist drugs | + | ||||
1 | Butorphanol | Drug Info | [29] | |||
2 | Codeine | Drug Info | [29] | |||
3 | Oxycodone | Drug Info | [1] | |||
4 | ADL-5747 | Drug Info | [33] | |||
5 | ADL-5859 | Drug Info | [33] | |||
6 | AZD-2327 | Drug Info | [34] | |||
7 | Carfentanil | Drug Info | [35] | |||
8 | Met-enkephalin | Drug Info | [36], [37] | |||
9 | MCP-201 | Drug Info | [40] | |||
10 | MCP-202 | Drug Info | [41] | |||
11 | DPI-3290 | Drug Info | [43] | |||
12 | BIO-306 | Drug Info | [25] | |||
13 | BW 373U86 | Drug Info | [50] | |||
14 | 3-Methylfentanyl | Drug Info | [67] | |||
15 | 3-Methylthiofentanyl | Drug Info | [68] | |||
16 | ARD-412 | Drug Info | [33] | |||
17 | BBI-11008 | Drug Info | [33] | |||
18 | Beta-endorphin | Drug Info | [83] | |||
19 | DADLE | Drug Info | [90], [91] | |||
20 | Dihydromorphine | Drug Info | [97] | |||
21 | Dimethylthiambutene | Drug Info | [98] | |||
22 | DPI-221 | Drug Info | [33] | |||
23 | DSLET | Drug Info | [33] | |||
24 | DSTBULET | Drug Info | [102] | |||
25 | dynorphin B | Drug Info | [33] | |||
26 | ethyketazocine | Drug Info | [106] | |||
27 | ethylketocyclazocine | Drug Info | [33] | |||
28 | Etorphine | Drug Info | [108] | |||
29 | Leucine-enkephalin | Drug Info | [133] | |||
30 | MCP-203 | Drug Info | [33] | |||
31 | MCP-204 | Drug Info | [33] | |||
32 | MCP-205 | Drug Info | [33] | |||
33 | normorphine | Drug Info | [33] | |||
34 | NRP290 | Drug Info | [33] | |||
35 | SB 227122 | Drug Info | [148] | |||
36 | SNC-80 | Drug Info | [150], [151] | |||
37 | Tonazocine mesylate | Drug Info | [151] | |||
38 | [3H]diprenorphine | Drug Info | [33] | |||
Modulator | [+] 3 Modulator drugs | + | ||||
1 | Eluxadoline | Drug Info | [30] | |||
2 | TRV250 | Drug Info | [21] | |||
3 | SB-219825 | Drug Info | [52] | |||
Binder | [+] 2 Binder drugs | + | ||||
1 | Hydromorphone | Drug Info | [31] | |||
2 | Loperamide | Drug Info | [32] | |||
Inhibitor | [+] 347 Inhibitor drugs | + | ||||
1 | TPM-1/Morphine | Drug Info | [38] | |||
2 | AIKO-150 | Drug Info | [39] | |||
3 | SALVINORIN A | Drug Info | [42] | |||
4 | Dynorphin a | Drug Info | [44] | |||
5 | LY-25582 | Drug Info | [47] | |||
6 | BIPHALIN | Drug Info | [49] | |||
7 | SB-213698 | Drug Info | [51] | |||
8 | SNF-9007 | Drug Info | [53] | |||
9 | (-)-cyclorphan | Drug Info | [54] | |||
10 | (-)-eseroline | Drug Info | [55] | |||
11 | (-)-isoelaeocarpiline | Drug Info | [56] | |||
12 | (H-Dmt-Tic-Glu-NH-(CH(2))(5)-CO-Dap(6DMN)-NH(2) | Drug Info | [57] | |||
13 | 1,10-bis-(Dmt-Tic-amino)decane | Drug Info | [58] | |||
14 | 1,4-bis-(Dmt-Tic-amino)butane | Drug Info | [58] | |||
15 | 1,6-bis-(Dmt-Tic-amino)hexane | Drug Info | [58] | |||
16 | 1,6-bis-(N,N-dimethyl-Dmt-Tic-NH)hexane | Drug Info | [58] | |||
17 | 1-(1,2-diphenylethyl)-4-phenylpiperidin-4-ol | Drug Info | [59] | |||
18 | 1-(2-ethoxy-1-phenylethyl)-4-phenylpiperidin-4-ol | Drug Info | [59] | |||
19 | 1-(dio-tolylmethyl)-4-phenylpiperidin-4-ol | Drug Info | [59] | |||
20 | 1-benzhydryl-4-(2-fluorophenyl)piperidin-4-ol | Drug Info | [60] | |||
21 | 1-benzhydryl-4-(2-methoxyphenyl)piperidin-4-ol | Drug Info | [60] | |||
22 | 1-benzhydryl-4-(3-fluorophenyl)piperidin-4-ol | Drug Info | [60] | |||
23 | 1-benzhydryl-4-(3-methoxyphenyl)piperidin-4-ol | Drug Info | [60] | |||
24 | 1-benzhydryl-4-(3-phenylpropyl)piperidin-4-ol | Drug Info | [60] | |||
25 | 1-benzhydryl-4-(4-bromophenyl)piperidin-4-ol | Drug Info | [60] | |||
26 | 1-benzhydryl-4-(4-chlorophenyl)piperidin-4-ol | Drug Info | [60] | |||
27 | 1-benzhydryl-4-(4-fluorophenyl)piperidin-4-ol | Drug Info | [60] | |||
28 | 1-benzhydryl-4-(4-methoxyphenyl)piperidin-4-ol | Drug Info | [60] | |||
29 | 1-benzhydryl-4-(benzyloxy)-4-phenylpiperidine | Drug Info | [59] | |||
30 | 1-benzhydryl-4-(furan-2-yl)piperidin-4-ol | Drug Info | [60] | |||
31 | 1-benzhydryl-4-(thiophen-2-yl)piperidin-4-ol | Drug Info | [60] | |||
32 | 1-benzhydryl-4-benzylpiperidin-4-ol | Drug Info | [60] | |||
33 | 1-benzhydryl-4-butylpiperidin-4-ol | Drug Info | [60] | |||
34 | 1-benzhydryl-4-cyclohexylpiperidin-4-ol | Drug Info | [60] | |||
35 | 1-benzhydryl-4-ethoxy-4-phenylpiperidine | Drug Info | [59] | |||
36 | 1-benzhydryl-4-hexylpiperidin-4-ol | Drug Info | [60] | |||
37 | 1-benzhydryl-4-m-tolylpiperidin-4-ol | Drug Info | [60] | |||
38 | 1-benzhydryl-4-methoxy-4-phenylpiperidine | Drug Info | [59] | |||
39 | 1-benzhydryl-4-o-tolylpiperidin-4-ol | Drug Info | [60] | |||
40 | 1-benzhydryl-4-p-tolylpiperidin-4-ol | Drug Info | [60] | |||
41 | 1-benzhydryl-4-phenyl-4-propoxypiperidine | Drug Info | [59] | |||
42 | 1-benzhydryl-4-phenylpiperidin-4-ol | Drug Info | [61] | |||
43 | 1-[3-(3-biphenyl)-(1,2,4-triazol-4-yl) ]-3-phenol | Drug Info | [62] | |||
44 | 1-[3-(4-biphenyl)-(1,2,4-triazol-4-yl) ]-3-phenol | Drug Info | [62] | |||
45 | 14-O-phenylpropylnaltrexone | Drug Info | [63] | |||
46 | 17-(Cyclobutylmethyl)-N-phenylmorphinan-3-amine | Drug Info | [64] | |||
47 | 17-(Cyclopropylmethyl)-N-phenylmorphinan-3-amine | Drug Info | [64] | |||
48 | 17-methyl-4'-methyldihydromorphinone | Drug Info | [65] | |||
49 | 17-Methylmorphinan-3-yl 4-Iodophenyl Carbamate | Drug Info | [64] | |||
50 | 2-Hydroxymethyl-3-hydroxymorphinan | Drug Info | [64] | |||
51 | 3,6-bis(Dmt-Tic-NH-butyl)-2(1H)-pyrazinone | Drug Info | [58] | |||
52 | 3,6-bis(Dmt-Tic-NH-ethyl)-2(1H)-pyrazinone | Drug Info | [58] | |||
53 | 3,6-bis(Dmt-Tic-NH-methyl)-2(1H)-pyrazinone | Drug Info | [58] | |||
54 | 3,6-bis(Dmt-Tic-NH-propyl)-2(1H)-pyrazinone | Drug Info | [58] | |||
55 | 3-desoxy-3-carboxamidonaltrexone | Drug Info | [66] | |||
56 | 4-(4-((phenethylamino)methyl)phenoxy)benzamide | Drug Info | [69] | |||
57 | 4-(p-Tolyl)spiro[chromene-2,4'-piperidine] | Drug Info | [70] | |||
58 | 4-(Spiro[chromene-2,4'-piperidine]-4-yl)benzamide | Drug Info | [71] | |||
59 | 4-(Spiro[chromene-2,4'-piperidine]-4-yl)phenol | Drug Info | [70] | |||
60 | 4-phenyl-1-(1-phenylbutyl)piperidin-4-ol | Drug Info | [59] | |||
61 | 4-phenyl-1-(1-phenylheptyl)piperidin-4-ol | Drug Info | [59] | |||
62 | 4-phenyl-1-(1-phenylhexyl)piperidin-4-ol | Drug Info | [59] | |||
63 | 4-phenyl-1-(1-phenylpentyl)piperidin-4-ol | Drug Info | [59] | |||
64 | 4-phenyl-1-(phenyl(m-tolyl)methyl)piperidin-4-ol | Drug Info | [59] | |||
65 | 4-phenyl-1-(phenyl(o-tolyl)methyl)piperidin-4-ol | Drug Info | [59] | |||
66 | 4-phenyl-1-(phenyl(p-tolyl)methyl)piperidin-4-ol | Drug Info | [59] | |||
67 | 4-phenyl-4-[1H-imidazol-2-yl]-piperidine | Drug Info | [72] | |||
68 | 4-Phenylspiro[chromene-2,4'-piperidine] | Drug Info | [70] | |||
69 | 5-(4-((phenethylamino)methyl)phenoxy)picolinamide | Drug Info | [69] | |||
70 | 6-(2-phenethylisoindolin-5-yloxy)nicotinamide | Drug Info | [73] | |||
71 | 6-(4-((benzylamino)methyl)phenoxy)nicotinamide | Drug Info | [69] | |||
72 | 6-(4-((phenethylamino)methyl)phenoxy)nicotinamide | Drug Info | [73] | |||
73 | 6-(4-(2-(benzylamino)ethyl)phenoxy)nicotinamide | Drug Info | [73] | |||
74 | 6-(4-(3-(benzylamino)propyl)phenoxy)nicotinamide | Drug Info | [69] | |||
75 | 6-(Allyl-methyl-amino)-4,4-diphenyl-heptan-3-ol | Drug Info | [74] | |||
76 | 6-cinnamoyl-N-methylstephasunoline | Drug Info | [75] | |||
77 | 6-cinnamoylhernandine | Drug Info | [75] | |||
78 | 6-desoxonaltrexone | Drug Info | [66] | |||
79 | 6beta-naltrexol HCl | Drug Info | [76] | |||
80 | 8-azabicyclo[3.2.1]octan-3-yloxy-benzamide | Drug Info | [78] | |||
81 | 8-carboxamidocyclazocine | Drug Info | [79] | |||
82 | AKNADILACTAM | Drug Info | [75] | |||
83 | AMINOFENTANYL | Drug Info | [80] | |||
84 | ANALOG OF DYNORPHIN A | Drug Info | [44] | |||
85 | Antanal 1 | Drug Info | [81] | |||
86 | Antanal 2 | Drug Info | [81] | |||
87 | Benzyl derivative of M6G | Drug Info | [82] | |||
88 | Bis-((-)-N-propargylmorphinan-3-yl) sebacoylate | Drug Info | [54] | |||
89 | BUTORPHAN | Drug Info | [84] | |||
90 | CARBOXYFENTANYL | Drug Info | [85] | |||
91 | Cis-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH | Drug Info | [86] | |||
92 | Clocinnamox | Drug Info | [63] | |||
93 | CTOP | Drug Info | [81] | |||
94 | CYCLAZOCINE | Drug Info | [87] | |||
95 | CYCLORPHAN | Drug Info | [64] | |||
96 | C[L-mTyr-D-pro-L-Phe-D-trp] | Drug Info | [88] | |||
97 | C[L-Phe-D-pro-L-mTyr-D-trp] | Drug Info | [88] | |||
98 | C[L-Phe-D-pro-L-Phe-L-trp] | Drug Info | [88] | |||
99 | D-Phe-Cys-Tyr-D-Trp-Arg-Thr-Pen-Thr-NH2(CTAP) | Drug Info | [89] | |||
100 | D-Phe-Cys-Tyr-D-Trp-Lys-Thr-Pen-Thr-NH2(CTP) | Drug Info | [89] | |||
101 | D-Phe-Cys-Tyr-D-Trp-Orn-Thr-Pen-Thr-NH2(CTOP) | Drug Info | [89] | |||
102 | D-PhGly-Cys-Tyr-D-Trp-Lys-Thr-Pen-Thr-NH2 | Drug Info | [89] | |||
103 | DAMGO | Drug Info | [92] | |||
104 | Dcp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2 | Drug Info | [93] | |||
105 | DELTORPHIN | Drug Info | [94] | |||
106 | DELTORPHIN-II | Drug Info | [95] | |||
107 | Deprotected cogener of M6G | Drug Info | [82] | |||
108 | DERMORPHIN | Drug Info | [96] | |||
109 | Dhp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2 | Drug Info | [93] | |||
110 | Dimepheptanol | Drug Info | [74] | |||
111 | Dmt-Pro-3,5Dmp-Phe-NH2 | Drug Info | [100] | |||
112 | Dmt-Pro-Dmp-Phe-NH2 | Drug Info | [100] | |||
113 | Dmt-Pro-Dmt-Phe-NH2 | Drug Info | [100] | |||
114 | Dmt-Pro-Emp-Phe-NH2 | Drug Info | [100] | |||
115 | Dmt-Pro-Imp-Phe-NH2 | Drug Info | [100] | |||
116 | Dmt-Pro-Mmp-Phe-NH2 | Drug Info | [100] | |||
117 | Dmt-Pro-Phe-D-1-Nal-NH2 | Drug Info | [101] | |||
118 | Dmt-Pro-Phe-D-2-Nal-NH2 | Drug Info | [101] | |||
119 | Dmt-Pro-Phe-Phe-NH2 | Drug Info | [100] | |||
120 | Dmt-Pro-Tmp-Phe-NH2 | Drug Info | [100] | |||
121 | Dmt-Pro-Trp-D-2-Nal-NH2 | Drug Info | [101] | |||
122 | DPDPE | Drug Info | [92] | |||
123 | ELAEOCARPENINE | Drug Info | [103] | |||
124 | ENDOMORPHIN 2 | Drug Info | [104] | |||
125 | ENDOMORPHIN-1 | Drug Info | [105] | |||
126 | ETONITAZENE | Drug Info | [107] | |||
127 | FALCARINDIOL | Drug Info | [109] | |||
128 | Grandisine C | Drug Info | [56] | |||
129 | Grandisine D | Drug Info | [56] | |||
130 | Grandisine F | Drug Info | [56] | |||
131 | H-2',6'-dimethyltyrosine-Tic-OH | Drug Info | [110] | |||
132 | H-2',6'-dimethyltyrosine-Tic-Phe-Phe-OH | Drug Info | [110] | |||
133 | H-Aba-ala-Gly-Phe-leu-OH | Drug Info | [37] | |||
134 | H-Aba-ala-Gly-Phe-Met-OH | Drug Info | [37] | |||
135 | H-Aba-Gly-Gly-Phe-Leu-OH | Drug Info | [37] | |||
136 | H-Aba-ser-Gly-Phe-Leu-Thr-OH | Drug Info | [37] | |||
137 | H-Apa-ala-Gly-Phe-leu-OH | Drug Info | [37] | |||
138 | H-Cdp-ala-Gly-Phe-leu-OH | Drug Info | [37] | |||
139 | H-Cdp-Gly-Gly-Phe-Leu-OH | Drug Info | [37] | |||
140 | H-Cdp-ser-Gly-Phe-Leu-Thr-OH | Drug Info | [37] | |||
141 | H-Cpa-c[pen-Gly-Phe-pen]OH | Drug Info | [37] | |||
142 | H-Cpa-Gly-Gly-Phe-Met-NH2 | Drug Info | [37] | |||
143 | H-Cpa-Gly-Gly-Phe-Met-OH | Drug Info | [37] | |||
144 | H-Cxp-ala-Gly-Phe-leu-OH | Drug Info | [37] | |||
145 | H-D-Tca-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2 | Drug Info | [111] | |||
146 | H-D-Tic-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2 | Drug Info | [111] | |||
147 | H-D-Trp-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2 | Drug Info | [111] | |||
148 | H-Dmt-Aba-Gly-NH-CH2-Bid | Drug Info | [112] | |||
149 | H-Dmt-Aba-Gly-NH-CH2-Ph | Drug Info | [112] | |||
150 | H-Dmt-Aba-Gly-NH-Ph | Drug Info | [112] | |||
151 | H-Dmt-D-Arg(NO2)-Phe-Lys(Z)-NH2 | Drug Info | [113] | |||
152 | H-Dmt-D-Arg(NO2)-Phe-Lys(Z)-OH | Drug Info | [113] | |||
153 | H-Dmt-Tic-(2R,3R)-beta-MeCha-Phe-NH2 | Drug Info | [114] | |||
154 | H-Dmt-Tic-(2R,3R)-beta-MeCha-Phe-OH | Drug Info | [114] | |||
155 | H-Dmt-Tic-(2R,3S)-beta-MeCha-Phe-NH2 | Drug Info | [114] | |||
156 | H-Dmt-Tic-(2R,3S)-beta-MeCha-Phe-OH | Drug Info | [114] | |||
157 | H-Dmt-Tic-(2S,3R)-beta-MeCha-Phe-NH2 | Drug Info | [114] | |||
158 | H-Dmt-Tic-(2S,3R)-beta-MeCha-Phe-OH | Drug Info | [114] | |||
159 | H-Dmt-Tic-(2S,3S)-beta-MeCha-Phe-NH2 | Drug Info | [114] | |||
160 | H-Dmt-Tic-(2S,3S)-beta-MeCha-Phe-OH | Drug Info | [114] | |||
161 | H-Dmt-Tic-Asp-N(Me)-Ph | Drug Info | [115] | |||
162 | H-Dmt-Tic-Asp-NH-Bzl | Drug Info | [115] | |||
163 | H-Dmt-Tic-Asp-NH-Ph | Drug Info | [115] | |||
164 | H-Dmt-Tic-D-Asp-N(Me)-Ph | Drug Info | [115] | |||
165 | H-Dmt-Tic-D-Asp-NH-Ph | Drug Info | [115] | |||
166 | H-Dmt-Tic-Glu-Dap(6DMN)-NH(2) | Drug Info | [57] | |||
167 | H-Dmt-Tic-Glu-NH-(CH2)5-NH2 | Drug Info | [116] | |||
168 | H-Dmt-Tic-Glu-NH2 | Drug Info | [116] | |||
169 | H-Dmt-Tic-Gly-N(Me)-Ph | Drug Info | [115] | |||
170 | H-Dmt-Tic-Gly-NH-Bzl | Drug Info | [115] | |||
171 | H-Dmt-Tic-Gly-NH-CH2-Bid | Drug Info | [112] | |||
172 | H-Dmt-Tic-Gly-NH-Ph | Drug Info | [115] | |||
173 | H-Dmt-Tic-Lys(Ac)-NH-CH2-Ph | Drug Info | [117] | |||
174 | H-Dmt-Tic-Lys(Ac)-NH-Ph | Drug Info | [117] | |||
175 | H-Dmt-Tic-Lys(Z)-NH-CH2-Ph | Drug Info | [117] | |||
176 | H-Dmt-Tic-Lys(Z)-NH-Ph | Drug Info | [117] | |||
177 | H-Dmt-Tic-Lys-NH-CH2-Ph | Drug Info | [117] | |||
178 | H-Dmt-Tic-Lys-NH-Ph | Drug Info | [117] | |||
179 | H-Dmt-Tic-NH-(CH2)6-NH-Dmt-H | Drug Info | [118] | |||
180 | H-Dmt-Tic-NH-(CH2)6-NH-Phe-H | Drug Info | [118] | |||
181 | H-Dmt-Tic-NH-(CH2)6-NH-Tic-H | Drug Info | [118] | |||
182 | H-Dmt-Tic-NH-(D)-CH[(CH2)4-NH-Z]-Bid | Drug Info | [117] | |||
183 | H-Dmt-Tic-NH-(R)CH(CH2-COOH)-Bid | Drug Info | [115] | |||
184 | H-Dmt-Tic-NH-(R)CH(CH2-COOH)-Bid(N1-Me) | Drug Info | [115] | |||
185 | H-Dmt-Tic-NH-(S)CH(CH2-COOH)-Bid(N1-Me) | Drug Info | [115] | |||
186 | H-Dmt-Tic-NH-CH2-Boa | Drug Info | [119] | |||
187 | H-Dmt-Tic-NH-CH2-Bta | Drug Info | [119] | |||
188 | H-Dmt-Tic-NH-CH2-CH2-NH2 | Drug Info | [120] | |||
189 | H-Dmt-Tic-NH-CH2-Imid | Drug Info | [119] | |||
190 | H-Dmt-Tic-NH-CH2-ImidPh | Drug Info | [119] | |||
191 | H-Dmt-Tic-NH-CH2-Indl | Drug Info | [119] | |||
192 | H-Dmt-Tic-NH-CH2-Indn | Drug Info | [119] | |||
193 | H-Dmt-Tic-NH-CH[(CH2)4-NH-Ac]-Bid | Drug Info | [117] | |||
194 | H-Dmt-Tic-NH-CH[(CH2)4-NH-Z]-Bid | Drug Info | [117] | |||
195 | H-Dmt-Tic-NH-CH[(CH2)4-NH2]-Bid | Drug Info | [117] | |||
196 | H-mCpa-ala-Gly-Phe-leu-OH | Drug Info | [37] | |||
197 | H-mCpa-Gly-Gly-Phe-Leu-OH | Drug Info | [37] | |||
198 | H-mCpa-ser-Gly-Phe-Leu-Thr-OH | Drug Info | [37] | |||
199 | H-Poa-ser-Gly-Phe-Leu-Thr-OH | Drug Info | [37] | |||
200 | H-Tyr-c[cys-Gly-Phe(p-NO2)-cys]NH2 | Drug Info | [37] | |||
201 | H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]-OH | Drug Info | [86] | |||
202 | H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]NH2 | Drug Info | [121] | |||
203 | H-Tyr-c[D-Allylgly-Gly-Phe-L-Allylgly]NH2 | Drug Info | [121] | |||
204 | H-Tyr-c[D-Cys-Gly-Phe-D-Cys]NH2 | Drug Info | [121] | |||
205 | H-Tyr-c[D-Cys-Gly-Phe-L-Cys]NH2 | Drug Info | [121] | |||
206 | H-Tyr-c[D-Orn-(D or L)Atc-Glu]-NH2 | Drug Info | [122] | |||
207 | H-Tyr-c[D-Orn-Aic-Glu]-NH2 | Drug Info | [122] | |||
208 | H-Tyr-c[pen-Gly-Phe-pen]OH | Drug Info | [37] | |||
209 | H-Tyr-D-Ala-Gly Phe-Pro-Leu-Trp-O-3,5-Bzl(CF3)2 | Drug Info | [123] | |||
210 | H-Tyr-D-Ala-Gly-Phe-NH-NH-(NMe)Phe-Asp-Nle-Trp-Ac | Drug Info | [124] | |||
211 | H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Phe-D-Asp-D-Nle-Trp-H | Drug Info | [125] | |||
212 | H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Trp-Nle-Asp-Phe-Bo | Drug Info | [125] | |||
213 | H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Trp-Nle-Asp-Phe-H | Drug Info | [125] | |||
214 | H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-D-Trp-Boc | Drug Info | [124] | |||
215 | H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-D-Trp-H | Drug Info | [124] | |||
216 | H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-Trp-Ac | Drug Info | [124] | |||
217 | H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-Trp-Boc | Drug Info | [124] | |||
218 | H-Tyr-D-Ala-Gly-Phe-NH-NH-Trp-D-Nle-D-Asp-D-Phe-H | Drug Info | [125] | |||
219 | H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NH-3,5-Bzl(CF3)2 | Drug Info | [123] | |||
220 | H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NH-Bzl | Drug Info | [123] | |||
221 | H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NMe-3,5-Bzl(CF3)2 | Drug Info | [123] | |||
222 | H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NMe-Bzl | Drug Info | [123] | |||
223 | H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-O-Bzl | Drug Info | [123] | |||
224 | H-Tyr-Gly-Gly-Phe-Met-NH2 | Drug Info | [37] | |||
225 | H-Tyr-NMe-D-Ala-Phe-Sar-NH2 | Drug Info | [126] | |||
226 | H-Tyr-Pro-Dap(6DMN)-Phe-NH2 | Drug Info | [57] | |||
227 | H-Tyr-Pro-Phe-Phe-NH-(CH2)5-(C=O)-Dap(6DMN)-NH2 | Drug Info | [57] | |||
228 | H-Tyr-Pro-Phe-Phe-NH-CH2-CH2-NH Tic Dmt-H | Drug Info | [120] | |||
229 | H-Tyr-Tic-Cha-Phe-OH | Drug Info | [114] | |||
230 | H-Tyr-Tic-OH | Drug Info | [110] | |||
231 | H-Tyr-Tic-Phe-Phe-OH | Drug Info | [114], [127] | |||
232 | HERKINORIN | Drug Info | [42] | |||
233 | HTyr-Gly-Gly-Phe-Leu-Arg-Arg-lle-Arg-Pro-LysNH2 | Drug Info | [128] | |||
234 | ICI-174864 | Drug Info | [130] | |||
235 | ICI-199441 | Drug Info | [131] | |||
236 | Isoelaeocarpine | Drug Info | [132] | |||
237 | LOFENTANIL | Drug Info | [134] | |||
238 | LONGANINE | Drug Info | [75] | |||
239 | Lophocladine a | Drug Info | [135] | |||
240 | M6G thiosaccharide analogue | Drug Info | [82] | |||
241 | MC-CAM | Drug Info | [136] | |||
242 | MCL-117 | Drug Info | [54] | |||
243 | MCL-139 | Drug Info | [54] | |||
244 | MCL-144 | Drug Info | [137] | |||
245 | MCL-145 | Drug Info | [54] | |||
246 | MCL-147 | Drug Info | [138] | |||
247 | MCL-149 | Drug Info | [138] | |||
248 | MCL-153 | Drug Info | [84] | |||
249 | MCL-154 | Drug Info | [84] | |||
250 | MCL-182 | Drug Info | [138] | |||
251 | MCL-183 | Drug Info | [138] | |||
252 | MCL-428 | Drug Info | [139] | |||
253 | MCL-429 | Drug Info | [139] | |||
254 | MCL-431 | Drug Info | [139] | |||
255 | MCL-432 | Drug Info | [139] | |||
256 | MCL-433 | Drug Info | [139] | |||
257 | MCL-434 | Drug Info | [139] | |||
258 | MCL-435 | Drug Info | [139] | |||
259 | MCL-443 | Drug Info | [139] | |||
260 | MCL-444 | Drug Info | [139] | |||
261 | MCL-445 | Drug Info | [138] | |||
262 | MCL-446 | Drug Info | [138] | |||
263 | MCL-447 | Drug Info | [138] | |||
264 | MCL-448 | Drug Info | [138] | |||
265 | MCL-449 | Drug Info | [139] | |||
266 | MCL-450 | Drug Info | [140] | |||
267 | MCL-451 | Drug Info | [140] | |||
268 | MCL-458 | Drug Info | [138] | |||
269 | METAZOCINE | Drug Info | [39] | |||
270 | N-(17-Methylmorphinan-3-yl)-N'-phenylurea | Drug Info | [64] | |||
271 | N-(4-Iodophenyl)-N'-(17-methylmorphinan-3-yl)urea | Drug Info | [64] | |||
272 | N-alpha-amidino-Tyr(Me)-Pro-Trp-p-Cl-Phe-NH2 | Drug Info | [141] | |||
273 | N-alpha-amidino-Tyr(Me)-Pro-Trp-Phe-NH2 | Drug Info | [141] | |||
274 | N-Benzyl-17-(cyclobutylmethyl)morphinan-3-amine | Drug Info | [64] | |||
275 | N-Benzyl-17-(cyclopropylmethyl)morphinan-3-amine | Drug Info | [64] | |||
276 | N-methylstephisoferulin | Drug Info | [75] | |||
277 | N-methylstephuline | Drug Info | [75] | |||
278 | Naltrexone-6-alpha-ol | Drug Info | [39] | |||
279 | NORBINALTORPHIMINE | Drug Info | [144] | |||
280 | O-DESMETHYL TRAMADOL | Drug Info | [39] | |||
281 | OXYMORPHINDOLE | Drug Info | [145] | |||
282 | PERIPENTADENINE | Drug Info | [146] | |||
283 | PHENAZOCINE | Drug Info | [39] | |||
284 | PROSTEPHABYSSINE | Drug Info | [75] | |||
285 | RTI-5989-23 | Drug Info | [47] | |||
286 | RTI-5989-25 | Drug Info | [47] | |||
287 | RTI-5989-31 | Drug Info | [147] | |||
288 | SB-0304 | Drug Info | [126] | |||
289 | SN-11 | Drug Info | [51] | |||
290 | SN-23 | Drug Info | [51] | |||
291 | SN-28 | Drug Info | [149] | |||
292 | SOMATOSTATIN | Drug Info | [89] | |||
293 | Trans-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH | Drug Info | [86] | |||
294 | Tyr-(NMe)Ala-L-Phe-D-Pro-NH2 | Drug Info | [153] | |||
295 | Tyr-(R)-Aba-Gly-Phe-NH2 | Drug Info | [154] | |||
296 | Tyr-(S)-Aba-Gly-Phe-NH2 | Drug Info | [154] | |||
297 | Tyr-(S)-spiro-Aba-Gly-Phe-NH2 | Drug Info | [154] | |||
298 | Tyr-D-Ala-Gly-D-Trp-Nle-Asp-Phe-NH2 | Drug Info | [53] | |||
299 | Tyr-D-Ala-Gly-D-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
300 | Tyr-D-Ala-Gly-Phe-Met-NH2 | Drug Info | [49] | |||
301 | Tyr-D-Ala-Gly-Phe-Met-Pro-Leu-Trp-NH-Bzl | Drug Info | [155] | |||
302 | Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-NMeNle-D-Trp-Boc | Drug Info | [124] | |||
303 | Tyr-D-Ala-Gly-Trp-Nle-Asp-Phe-NH2 | Drug Info | [53] | |||
304 | Tyr-D-Ala-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
305 | Tyr-D-Ala-Phe-Asp-Val-Val-Thr[Beta-D-Glc]-Gly-NH2 | Drug Info | [156] | |||
306 | Tyr-D-Ala-Phe-Glu-Val-Val-Gly-NH2 | Drug Info | [157] | |||
307 | Tyr-D-Ala-Phe-Gly-Tyr-Pro-Thr(Beta-D-Glc)-Gly-NH2 | Drug Info | [156] | |||
308 | Tyr-D-Ala-Phe-Thr(-D-Glc)-Tyr-Pro-Ser-NH2 | Drug Info | [156] | |||
309 | Tyr-D-Met-Phe-His-Leu-Met-Asp-NH2 | Drug Info | [157] | |||
310 | Tyr-D-Nle-Gly-D-Trp-Nle-Asp-Phe-NH2 | Drug Info | [53] | |||
311 | Tyr-D-Nle-Gly-D-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
312 | Tyr-D-Nle-Gly-Trp-Nle-Asp-Phe-NH2 | Drug Info | [53] | |||
313 | Tyr-D-Nle-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
314 | Tyr-D-Phe-Gly-D-Trp-Nle-Asp-Phe-NH2 | Drug Info | [53] | |||
315 | Tyr-D-Phe-Gly-D-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
316 | Tyr-D-Phe-Gly-Trp-Nle-Asp-Phe-NH2 | Drug Info | [53] | |||
317 | Tyr-D-Phe-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
318 | Tyr-D-Pro-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
319 | Tyr-Gly-Gly-Phe-c(Cys-Arg-Arg-Ile-Cys)-Arg-lys | Drug Info | [44] | |||
320 | Tyr-Gly-Gly-Phe-leu-c(Cys-Arg-Ile-Arg-Cys)-lys | Drug Info | [44] | |||
321 | Tyr-Gly-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
322 | Tyr-Pro-3,5Dmp-Phe-NH2 | Drug Info | [100] | |||
323 | Tyr-Pro-D-Phe-D-Pro-NH2 | Drug Info | [153] | |||
324 | Tyr-Pro-D-Phe-Pro-NH2 | Drug Info | [153] | |||
325 | Tyr-Pro-D-Phg-Phe-NH2 | Drug Info | [158] | |||
326 | Tyr-Pro-Dmp-Phe-NH2 | Drug Info | [100] | |||
327 | Tyr-Pro-Dmt-Phe-NH2 | Drug Info | [100] | |||
328 | Tyr-Pro-Emp-Phe-NH2 | Drug Info | [100] | |||
329 | Tyr-Pro-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
330 | Tyr-Pro-Imp-Phe-NH2 | Drug Info | [100] | |||
331 | Tyr-Pro-L-(NMe)Phe-D-Pro-NH2 | Drug Info | [153] | |||
332 | Tyr-Pro-L-(NMe)Phe-Pro-NH2 | Drug Info | [153] | |||
333 | Tyr-Pro-L-Phe-D-Pro-NH2 | Drug Info | [153] | |||
334 | Tyr-Pro-L-Phe-Pro-NH2 | Drug Info | [153] | |||
335 | Tyr-Pro-Mmp-Phe-NH | Drug Info | [100] | |||
336 | Tyr-Pro-Phe-Phe-N(CH3)2 | Drug Info | [159] | |||
337 | Tyr-Pro-Phe-Phe-NHCH3 | Drug Info | [159] | |||
338 | Tyr-Pro-Phe-Phe-NHNH2 | Drug Info | [159] | |||
339 | Tyr-Pro-Phe-Phe-OC(CH3)3 | Drug Info | [159] | |||
340 | Tyr-Pro-Phe-Phe-OCH2CH3 | Drug Info | [159] | |||
341 | Tyr-Pro-Phe-Phe-OCH2OH | Drug Info | [159] | |||
342 | Tyr-Pro-Phe-Phe-OCH3 | Drug Info | [159] | |||
343 | Tyr-Pro-Tmp-Phe-NH | Drug Info | [100] | |||
344 | UFP-502 | Drug Info | [95] | |||
345 | UFP-512 | Drug Info | [95] | |||
346 | [Dcp1]Dyn A(1-11)-NH2 | Drug Info | [93] | |||
347 | [Leu5]enkephalin | Drug Info | [161] | |||
Antagonist | [+] 11 Antagonist drugs | + | ||||
1 | TRK-851 | Drug Info | [8], [45] | |||
2 | SoRI-9409 | Drug Info | [48] | |||
3 | 7-benzylidenenaltrexone | Drug Info | [77] | |||
4 | CTAP | Drug Info | [33] | |||
5 | Diprenorphine | Drug Info | [99] | |||
6 | ICI 154129 | Drug Info | [129] | |||
7 | naltriben | Drug Info | [142], [143] | |||
8 | quadazocine | Drug Info | [33] | |||
9 | TIP | Drug Info | [127] | |||
10 | TIPPpsi | Drug Info | [152] | |||
11 | [3H]naltrindole | Drug Info | [77], [160] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
1 | cGMP-PKG signaling pathway | |||||
2 | Sphingolipid signaling pathway | |||||
3 | Neuroactive ligand-receptor interaction | |||||
Panther Pathway | [+] 5 Panther Pathways | + | ||||
1 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
2 | Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
3 | Enkephalin release | |||||
4 | Opioid proenkephalin pathway | |||||
5 | Opioid proopiomelanocortin pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Peptide ligand-binding receptors | |||||
2 | G alpha (i) signalling events | |||||
WikiPathways | [+] 4 WikiPathways | + | ||||
1 | GPCRs, Class A Rhodopsin-like | |||||
2 | Peptide GPCRs | |||||
3 | GPCR ligand binding | |||||
4 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Oxycodone: a pharmacological and clinical review. Clin Transl Oncol. 2007 May;9(5):298-307. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7591). | |||||
REF 3 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075046. | |||||
REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1673). | |||||
REF 5 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074256. | |||||
REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7691). | |||||
REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031329) | |||||
REF 8 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7093). | |||||
REF 10 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 085910. | |||||
REF 11 | ClinicalTrials.gov (NCT01058642) Study to Assess the Efficacy, Safety, and Tolerability of ADL5747 in Patients With Postherpetic Neuralgia. U.S. National Institutes of Health. | |||||
REF 12 | ClinicalTrials.gov (NCT00626275) Study Evaluating the Analgesic Efficacy and Safety of ADL5859 in Subjects With Rheumatoid Arthritis. U.S. National Institutes of Health. | |||||
REF 13 | ClinicalTrials.gov (NCT00759395) Study of Antidepressant Efficacy of a Selective, High Affinity Enkephalinergic Agonist in Anxious Major Depressive Disorder (AMDD). U.S. National Institutes of Health. | |||||
REF 14 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1614). | |||||
REF 15 | ClinicalTrials.gov (NCT00109941) Opioid Growth Factor in Treating Patients With Advanced Pancreatic Cancer That Cannot Be Removed By Surgery. U.S. National Institutes of Health. | |||||
REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023017) | |||||
REF 17 | ClinicalTrials.gov (NCT00829777) Safety Study of Intravenous 6 Naltrexol (AIKO-150) in Opioid-Dependent Subjects. U.S. National Institutes of Health. | |||||
REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018011) | |||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018026) | |||||
REF 20 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 21 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 22 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010668) | |||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015232) | |||||
REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025668) | |||||
REF 25 | Pharmacologic therapeutics for cardiac reperfusion injury. Expert Opin Emerg Drugs. 2007 Sep;12(3):367-88. | |||||
REF 26 | Emerging drugs for obesity: linking novel biological mechanisms to pharmaceutical pipelines. Expert Opin Emerg Drugs. 2005 Aug;10(3):643-60. | |||||
REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028893) | |||||
REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008418) | |||||
REF 29 | Butorphanol: effects of a prototypical agonist-antagonist analgesic on kappa-opioid receptors. J Pharmacol Sci. 2005 Jun;98(2):109-16. | |||||
REF 30 | Molecular characterization of eluxadoline as a potential ligand targeting mu-delta opioid receptor heteromers.Biochem Pharmacol.2014 Dec 1;92(3):448-56. | |||||
REF 31 | Identification of opioid ligands possessing mixed micro agonist/delta antagonist activity among pyridomorphinans derived from naloxone, oxymorphone, and hydromorphone [correction of hydropmorphone]. J Med Chem. 2004 Mar 11;47(6):1400-12. | |||||
REF 32 | Loperamide: evidence of interaction with mu and delta opioid receptors. Life Sci. 1983;33 Suppl 1:315-8. | |||||
REF 33 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 317). | |||||
REF 34 | Preclinical pharmacology of AZD2327: a highly selective agonist of the delta-opioid receptor. J Pharmacol Exp Ther. 2011 Jul;338(1):195-204. | |||||
REF 35 | Wax PM, Becker CE, Curry SC: Unexpected gas casualties in Moscow: a medical toxicology perspective. Ann Emerg Med. 2003 May;41(5):700-5. | |||||
REF 36 | Delta-opioid receptor agonists inhibit neuromuscular transmission in human colon. Eur J Pharmacol. 1994 Sep 1;262(1-2):33-9. | |||||
REF 37 | Further studies of tyrosine surrogates in opioid receptor peptide ligands. Bioorg Med Chem Lett. 2007 May 1;17(9):2656-60. | |||||
REF 38 | Molecular Mechanisms of Opioid Receptor-Dependent Signaling and Behavior. Anesthesiology. 2011 December; 115(6): 1363-1381. | |||||
REF 39 | Syntheses and opioid receptor binding properties of carboxamido-substituted opioids. Bioorg Med Chem Lett. 2009 Jan 1;19(1):203-8. | |||||
REF 40 | US patent application no. 6,924,288, Enantiomerically pure opioid diarylmethylpiperzine and methods of using same. | |||||
REF 41 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018026) | |||||
REF 42 | Herkinorin analogues with differential beta-arrestin-2 interactions. J Med Chem. 2008 Apr 24;51(8):2421-31. | |||||
REF 43 | DPI-3290 [(+)-3-((alpha-R)-alpha-((2S,5R)-4-Allyl-2,5-dimethyl-1-piperazinyl)-3-hydroxybenzyl)-N-(3-fluorophenyl)-N-methylbenzamide]. II. A mixed opioid agonist with potent antinociceptive activity and limited effects on respiratory function. J Pharmacol Exp Ther. 2003 Dec;307(3):1227-33. | |||||
REF 44 | Design and synthesis of highly potent and selective cyclic dynorphin A analogs. 2. New analogs. J Med Chem. 1993 Mar 19;36(6):750-7. | |||||
REF 45 | Design and synthesis of a metabolically stable and potent antitussive agent, a novel delta opioid receptor antagonist, TRK-851. Bioorg Med Chem. 2008 Sep 1;16(17):7956-67. | |||||
REF 46 | WO patent application no. 2007,0677,14, Treatment of sequelae of psychiatric disorders. | |||||
REF 47 | Investigation of the N-substituent conformation governing potency and mu receptor subtype-selectivity in (+)-(3R, 4R)-dimethyl-4-(3-hydroxyphenyl)p... J Med Chem. 1998 May 21;41(11):1980-90. | |||||
REF 48 | In vivo pharmacological characterization of SoRI 9409, a nonpeptidic opioid mu-agonist/delta-antagonist that produces limited antinociceptive tolerance and attenuates morphine physical dependence. J Pharmacol Exp Ther. 2001 May;297(2):597-605. | |||||
REF 49 | The biological activity and metabolic stability of peptidic bifunctional compounds that are opioid receptor agonists and neurokinin-1 receptor anta... Bioorg Med Chem. 2009 Oct 15;17(20):7337-43. | |||||
REF 50 | BW373U86, a delta opioid agonist, partially mediates delayed cardioprotection via a free radical mechanism that is independent of opioid receptor stimulation. J Mol Cell Cardiol. 2001 Aug;33(8):1455-65. | |||||
REF 51 | Design and synthesis of novel delta opioid receptor agonists and their pharmacologies. Bioorg Med Chem Lett. 2009 May 15;19(10):2792-5. | |||||
REF 52 | Mutation W284L of the human delta opioid receptor reveals agonist specific receptor conformations for G protein activation. Life Sci. 2001 Apr 6;68(19-20):2233-42. | |||||
REF 53 | Structure-activity relationships of bifunctional peptides based on overlapping pharmacophores at opioid and cholecystokinin receptors. J Med Chem. 2006 May 18;49(10):2868-75. | |||||
REF 54 | Synthesis and preliminary in vitro investigation of bivalent ligands containing homo- and heterodimeric pharmacophores at mu, delta, and kappa opio... J Med Chem. 2006 Jan 12;49(1):256-62. | |||||
REF 55 | Akuammine and dihydroakuammine, two indolomonoterpene alkaloids displaying affinity for opioid receptors. J Nat Prod. 1992 Mar;55(3):380-4. | |||||
REF 56 | Grandisines C-G, indolizidine alkaloids from the Australian rainforest tree Elaeocarpus grandis. J Nat Prod. 2006 Sep;69(9):1295-9. | |||||
REF 57 | 6-N,N-dimethylamino-2,3-naphthalimide: a new environment-sensitive fluorescent probe in delta- and mu-selective opioid peptides. J Med Chem. 2006 Jun 15;49(12):3653-8. | |||||
REF 58 | Potent Dmt-Tic pharmacophoric delta- and mu-opioid receptor antagonists. J Med Chem. 2005 Dec 15;48(25):8035-44. | |||||
REF 59 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):3023-7. Epub 2007 Mar 23.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 1. | |||||
REF 60 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):3028-33. Epub 2007 Mar 21.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 2. | |||||
REF 61 | The discovery of tropane derivatives as nociceptin receptor ligands for the management of cough and anxiety. Bioorg Med Chem Lett. 2009 May 1;19(9):2519-23. | |||||
REF 62 | Discovery of novel triazole-based opioid receptor antagonists. J Med Chem. 2006 Jul 13;49(14):4044-7. | |||||
REF 63 | 14 beta-O-cinnamoylnaltrexone and related dihydrocodeinones are mu opioid receptor partial agonists with predominant antagonist activity. J Med Chem. 2009 Mar 26;52(6):1553-7. | |||||
REF 64 | Synthesis and opioid receptor binding affinities of 2-substituted and 3-aminomorphinans: ligands for mu, kappa, and delta opioid receptors. J Med Chem. 2010 Jan 14;53(1):402-18. | |||||
REF 65 | Structural determinants of opioid activity in derivatives of 14-aminomorphinones: effect of substitution in the aromatic ring of cinnamoylaminomorp... J Med Chem. 2006 Aug 24;49(17):5333-8. | |||||
REF 66 | Syntheses of novel high affinity ligands for opioid receptors. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2289-94. | |||||
REF 67 | Subramanian G, Paterlini MG, Portoghese PS, Ferguson DM: Molecular docking reveals a novel binding site model for fentanyl at the mu-opioid receptor. J Med Chem. 2000 Feb 10;43(3):381-91. | |||||
REF 68 | You HJ, Colpaert FC, Arendt-Nielsen L: The novel analgesic and high-efficacy 5-HT1A receptor agonist F 13640 inhibits nociceptive responses, wind-up, and after-discharges in spinal neurons and withdrawal reflexes. Exp Neurol. 2005 Jan;191(1):174-83. | |||||
REF 69 | Structure-activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 1. Bioorg Med Chem Lett. 2007 Oct 1;17(19):5349-52. | |||||
REF 70 | Potent, orally bioavailable delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-4-(5-hydroxyspiro[chromene-2,4'-pipe... J Med Chem. 2008 Oct 9;51(19):5893-6. | |||||
REF 71 | Spirocyclic delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-3-hydroxy-4-(spiro[chromene-2,4'-piperidine]-4-yl) b... J Med Chem. 2009 Sep 24;52(18):5685-702. | |||||
REF 72 | 4-Phenyl-4-[1H-imidazol-2-yl]-piperidine derivatives, a novel class of selective delta-opioid agonists. Bioorg Med Chem Lett. 2006 Jan 1;16(1):146-9. | |||||
REF 73 | Structure activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 2. Bioorg Med Chem Lett. 2007 Dec 15;17(24):6841-6. | |||||
REF 74 | Synthesis of analogues of acetylmethadol and methadol as potential narcotic antagonists. J Med Chem. 1981 Jul;24(7):903-6. | |||||
REF 75 | Hasubanan alkaloids with delta-opioid binding affinity from the aerial parts of Stephania japonica. J Nat Prod. 2010 May 28;73(5):988-91. | |||||
REF 76 | Design, synthesis, and characterization of 6beta-naltrexol analogs, and their selectivity for in vitro opioid receptor subtypes. Bioorg Med Chem Lett. 2009 May 15;19(10):2811-4. | |||||
REF 77 | Delta-opioid receptor antagonists as a new concept for central acting antitussive drugs. Pulm Pharmacol Ther. 2002;15(3):235-40. | |||||
REF 78 | SAR development of a series of 8-azabicyclo[3.2.1]octan-3-yloxy-benzamides as kappa opioid receptor antagonists. Part 2. Bioorg Med Chem Lett. 2010 Sep 15;20(18):5405-10. | |||||
REF 79 | Redefining the structure-activity relationships of 2,6-methano-3-benzazocines. Part 6: Opioid receptor binding properties of cyclic variants of 8-c... Bioorg Med Chem. 2008 May 15;16(10):5653-64. | |||||
REF 80 | Synthesis and evaluation of 3-aminopropionyl substituted fentanyl analogues for opioid activity. Bioorg Med Chem Lett. 2006 Sep 15;16(18):4946-50. | |||||
REF 81 | Novel opioid peptide derived antagonists containing (2S)-2-methyl-3-(2,6-dimethyl-4-carbamoylphenyl)propanoic acid [(2S)-Mdcp]. J Med Chem. 2008 Sep 25;51(18):5866-70. | |||||
REF 82 | Synthesis and in vitro biological evaluation of a carbon glycoside analogue of morphine-6-glucuronide. Bioorg Med Chem Lett. 2005 Mar 15;15(6):1583-6. | |||||
REF 83 | Cross-linking of human [125I]beta-endorphin to opioid receptors in rat striatal membranes: biochemical evidence for the existence of a mu/delta opioid receptor complex. J Pharmacol Exp Ther. 1990 Apr;253(1):419-26. | |||||
REF 84 | Effect of linker substitution on the binding of butorphan univalent and bivalent ligands to opioid receptors. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1507-9. | |||||
REF 85 | Development of novel enkephalin analogues that have enhanced opioid activities at both mu and delta opioid receptors. J Med Chem. 2007 Nov 1;50(22):5528-32. | |||||
REF 86 | Synthesis of stable and potent delta/mu opioid peptides: analogues of H-Tyr-c[D-Cys-Gly-Phe-D-Cys]-OH by ring-closing metathesis. J Med Chem. 2007 Jun 28;50(13):3138-42. | |||||
REF 87 | Redefining the structure-activity relationships of 2,6-methano-3-benzazocines. Part 7: syntheses and opioid receptor properties of cyclic variants ... Bioorg Med Chem Lett. 2009 Jan 15;19(2):365-8. | |||||
REF 88 | Nascent structure-activity relationship study of a diastereomeric series of kappa opioid receptor antagonists derived from CJ-15,208. Bioorg Med Chem Lett. 2009 Jul 1;19(13):3647-50. | |||||
REF 89 | Design and synthesis of conformationally constrained somatostatin analogues with high potency and specificity for mu opioid receptors. J Med Chem. 1986 Nov;29(11):2370-5. | |||||
REF 90 | Delta opioid receptor stimulation mimics ischemic preconditioning in human heart muscle. J Am Coll Cardiol. 2000 Dec;36(7):2296-302. | |||||
REF 91 | Design, synthesis, and biological evaluation of novel bifunctional C-terminal-modified peptides for delta/mu opioid receptor agonists and neurokini... J Med Chem. 2007 Jun 14;50(12):2779-86. | |||||
REF 92 | Evaluation of N-substitution in 6,7-benzomorphan compounds. Bioorg Med Chem. 2010 Jul 15;18(14):4975-82. | |||||
REF 93 | Replacement of the N-terminal tyrosine residue in opioid peptides with 3-(2,6-dimethyl-4-carbamoylphenyl)propanoic acid (Dcp) results in novel opio... J Med Chem. 2006 Aug 24;49(17):5382-5. | |||||
REF 94 | Cyclic enkephalin analogs with exceptional potency at peripheral delta opioid receptors. J Med Chem. 1994 Jan 7;37(1):146-50. | |||||
REF 95 | Role of 2',6'-dimethyl-l-tyrosine (Dmt) in some opioid lead compounds. Bioorg Med Chem. 2010 Aug 15;18(16):6024-30. | |||||
REF 96 | Conversion of the potent delta-opioid agonist H-Dmt-Tic-NH-CH(2)-bid into delta-opioid antagonists by N(1)-benzimidazole alkylation(1). J Med Chem. 2005 Dec 29;48(26):8112-4. | |||||
REF 97 | Opiate receptor binding properties of morphine-, dihydromorphine-, and codeine 6-O-sulfate ester congeners. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4291-5. | |||||
REF 98 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
REF 99 | [6-O-methyl-11C]Diprenorphine Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. | |||||
REF 100 | Bifunctional [2',6'-dimethyl-L-tyrosine1]endomorphin-2 analogues substituted at position 3 with alkylated phenylalanine derivatives yield potent mi... J Med Chem. 2007 Jun 14;50(12):2753-66. | |||||
REF 101 | Synthesis and characterization of potent and selective mu-opioid receptor antagonists, [Dmt(1), D-2-Nal(4)]endomorphin-1 (Antanal-1) and [Dmt(1), D... J Med Chem. 2007 Feb 8;50(3):512-20. | |||||
REF 102 | [3H][D-Ser2(O-tert-butyl),Leu5]enkephalyl-Thr6 and [D-Ser2(O-tert-butyl),Leu5]enkephalyl-Thr6(O-tert-butyl). Two new enkephalin analogs with both a good selectivity and a high affinity toward delta-opioid binding sites. J Biol Chem. 1988 Mar 25;263(9):4124-30. | |||||
REF 103 | Synthesis and evaluation of opioid receptor-binding affinity of elaeocarpenine and its analogs. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1601-3. | |||||
REF 104 | Synthesis and activity of endomorphin-2 and morphiceptin analogues with proline surrogates in position 2. Eur J Med Chem. 2010 Oct;45(10):4594-600. | |||||
REF 105 | New endomorphin analogues containing alicyclic beta-amino acids: influence on bioactive conformation and pharmacological profile. J Med Chem. 2008 Jul 24;51(14):4270-9. | |||||
REF 106 | Cloning and functional comparison of kappa and delta opioid receptors from mouse brain. Proc Natl Acad Sci U S A. 1993 Jul 15;90(14):6736-40. | |||||
REF 107 | Photoactivatable opiate derivatives as irreversible probes of the mu-opioid receptor. J Med Chem. 1990 Sep;33(9):2456-64. | |||||
REF 108 | Agonist-, antagonist-, and inverse agonist-regulated trafficking of the delta-opioid receptor correlates with, but does not require, G protein activation. J Pharmacol Exp Ther. 2001 Sep;298(3):1015-20. | |||||
REF 109 | Novel coumarin glycoside and phenethyl vanillate from Notopterygium forbesii and their binding affinities for opioid and dopamine receptors. Bioorg Med Chem. 2008 Mar 15;16(6):3218-23. | |||||
REF 110 | Agonist vs antagonist behavior of delta opioid peptides containing novel phenylalanine analogues in place of Tyr(1). J Med Chem. 2009 Nov 12;52(21):6941-5. | |||||
REF 111 | Opiate aromatic pharmacophore structure-activity relationships in CTAP analogues determined by topographical bias, two-dimensional NMR, and biologi... J Med Chem. 2000 Feb 24;43(4):569-80. | |||||
REF 112 | New 2',6'-dimethyl-L-tyrosine (Dmt) opioid peptidomimetics based on the Aba-Gly scaffold. Development of unique mu-opioid receptor ligands. J Med Chem. 2006 Jun 29;49(13):3990-3. | |||||
REF 113 | From the potent and selective mu opioid receptor agonist H-Dmt-d-Arg-Phe-Lys-NH(2) to the potent delta antagonist H-Dmt-Tic-Phe-Lys(Z)-OH. J Med Chem. 2005 Aug 25;48(17):5608-11. | |||||
REF 114 | Beta-methyl substitution of cyclohexylalanine in Dmt-Tic-Cha-Phe peptides results in highly potent delta opioid antagonists. J Med Chem. 2007 Jan 25;50(2):328-33. | |||||
REF 115 | Further studies on lead compounds containing the opioid pharmacophore Dmt-Tic. J Med Chem. 2008 Aug 28;51(16):5109-17. | |||||
REF 116 | Highly selective fluorescent analogue of the potent delta-opioid receptor antagonist Dmt-Tic. J Med Chem. 2004 Dec 16;47(26):6541-6. | |||||
REF 117 | Effect of lysine at C-terminus of the Dmt-Tic opioid pharmacophore. J Med Chem. 2006 Sep 7;49(18):5610-7. | |||||
REF 118 | New series of potent delta-opioid antagonists containing the H-Dmt-Tic-NH-hexyl-NH-R motif. Bioorg Med Chem Lett. 2005 Dec 15;15(24):5517-20. | |||||
REF 119 | Role of benzimidazole (Bid) in the delta-opioid agonist pseudopeptide H-Dmt-Tic-NH-CH(2)-Bid (UFP-502). Bioorg Med Chem. 2008 Mar 15;16(6):3032-8. | |||||
REF 120 | A new opioid designed multiple ligand derived from the micro opioid agonist endomorphin-2 and the delta opioid antagonist pharmacophore Dmt-Tic. Bioorg Med Chem. 2007 Nov 15;15(22):6876-81. | |||||
REF 121 | Dicarba analogues of the cyclic enkephalin peptides H-Tyr-c[D-Cys-Gly-Phe-D(or L)-Cys]NH(2) retain high opioid activity. J Med Chem. 2007 Mar 22;50(6):1414-7. | |||||
REF 122 | Conformational restriction of the phenylalanine residue in a cyclic opioid peptide analogue: effects on receptor selectivity and stereospecificity. J Med Chem. 1991 Oct;34(10):3125-32. | |||||
REF 123 | A structure-activity relationship study and combinatorial synthetic approach of C-terminal modified bifunctional peptides that are delta/mu opioid ... J Med Chem. 2008 Mar 13;51(5):1369-76. | |||||
REF 124 | Design and synthesis of novel hydrazide-linked bifunctional peptides as delta/mu opioid receptor agonists and CCK-1/CCK-2 receptor antagonists. J Med Chem. 2006 Mar 9;49(5):1773-80. | |||||
REF 125 | Partial retro-inverso, retro, and inverso modifications of hydrazide linked bifunctional peptides for opioid and cholecystokinin (CCK) receptors. J Med Chem. 2007 Jan 11;50(1):165-8. | |||||
REF 126 | Blood-brain barrier penetration by two dermorphin tetrapeptide analogues: role of lipophilicity vs structural flexibility. J Med Chem. 2008 Apr 24;51(8):2571-4. | |||||
REF 127 | The TIPP opioid peptide family: development of delta antagonists, delta agonists, and mixed mu agonist/delta antagonists. Biopolymers. 1999;51(6):411-25. | |||||
REF 128 | The effects of C-terminal modifications on the opioid activity of [N-benzylTyr(1)]dynorphin A-(1-11) analogues. J Med Chem. 2009 Nov 12;52(21):6814-21. | |||||
REF 129 | In vivo evidence for the selectivity of ICI 154129 for the delta-opioid receptor. Neuropharmacology. 1985 Feb;24(2):107-10. | |||||
REF 130 | Highly potent and selective phenylmorphan-based inverse agonists of the opioid delta receptor. J Med Chem. 2006 Sep 7;49(18):5597-609. | |||||
REF 131 | Arylacetamide kappa opioid receptor agonists with reduced cytochrome P450 2D6 inhibitory activity. Bioorg Med Chem Lett. 2005 May 16;15(10):2647-52. | |||||
REF 132 | Indolizidine alkaloids with delta-opioid receptor binding affinity from the leaves of Elaeocarpus fuscoides. J Nat Prod. 2007 May;70(5):872-5. | |||||
REF 133 | Inverse agonist action of Leu-enkephalin at delta(2)-opioid receptors mediates spinal antianalgesia. J Pharmacol Exp Ther. 2001 May;297(2):582-9. | |||||
REF 134 | Potential affinity labels for the opiate receptor based on fentanyl and related compounds. J Med Chem. 1982 Aug;25(8):913-9. | |||||
REF 135 | Lophocladines, bioactive alkaloids from the red alga Lophocladia sp. J Nat Prod. 2006 Apr;69(4):640-4. | |||||
REF 136 | 14beta-Arylpropiolylamino-17-cyclopropylmethyl-7,8-dihydronormorphinones and related opioids. Further examples of pseudoirreversible mu opioid rece... J Med Chem. 2009 Nov 12;52(21):6926-30. | |||||
REF 137 | Univalent and bivalent ligands of butorphan: characteristics of the linking chain determine the affinity and potency of such opioid ligands. J Med Chem. 2009 Dec 10;52(23):7389-96. | |||||
REF 138 | In-vitro investigation of oxazol and urea analogues of morphinan at opioid receptors. Bioorg Med Chem. 2007 Jun 15;15(12):4106-12. | |||||
REF 139 | High-affinity carbamate analogues of morphinan at opioid receptors. Bioorg Med Chem Lett. 2007 Mar 15;17(6):1508-11. | |||||
REF 140 | New opioid designed multiple ligand from Dmt-Tic and morphinan pharmacophores. J Med Chem. 2006 Sep 7;49(18):5640-3. | |||||
REF 141 | Endomorphin-1 analogs with enhanced metabolic stability and systemic analgesic activity: design, synthesis, and pharmacological characterization. Bioorg Med Chem. 2007 Feb 15;15(4):1694-702. | |||||
REF 142 | Differential antagonism of delta opioid agonists by naltrindole and its benzofuran analog (NTB) in mice: evidence for delta opioid receptor subtypes. J Pharmacol Exp Ther. 1991 May;257(2):676-80. | |||||
REF 143 | Selective in vivo binding of [3H]naltriben to delta-opioid receptors in mouse brain. Eur J Pharmacol. 1998 Jun 5;350(2-3):335-44. | |||||
REF 144 | Identification of (3R)-7-hydroxy-N-((1S)-1-[[(3R,4R)-4-(3-hydroxyphenyl)- 3,4-dimethyl-1-piperidinyl]methyl]-2-methylpropyl)-1,2,3,4-tetrahydro- 3-... J Med Chem. 2003 Jul 3;46(14):3127-37. | |||||
REF 145 | Ligand binding to nucleic acids and proteins: Does selectivity increase with strength Eur J Med Chem. 2008 Nov;43(11):2307-15. | |||||
REF 146 | Alkaloids with human delta-opioid receptor binding affinity from the Australian rainforest tree Peripentadenia mearsii. J Nat Prod. 2007 Dec;70(12):1946-50. | |||||
REF 147 | Probes for narcotic receptor mediated phenomena. 34. Synthesis and structure-activity relationships of a potent mu-agonist delta-antagonist and an ... J Med Chem. 2007 Aug 9;50(16):3765-76. | |||||
REF 148 | The antitussive activity of delta-opioid receptor stimulation in guinea pigs. J Pharmacol Exp Ther. 2000 Feb;292(2):803-9. | |||||
REF 149 | Design and synthesis of KNT-127, a -opioid receptor agonist effective by systemic administration. Bioorg Med Chem Lett. 2010 Nov 1;20(21):6302-5. | |||||
REF 150 | Nonpeptidic delta-opioid receptor agonists reduce immobility in the forced swim assay in rats. Neuropsychopharmacology. 2002 Jun;26(6):744-55. | |||||
REF 151 | Antiparkinson potential of delta-opioid receptor agonists. Eur J Pharmacol. 2000 May 19;396(2-3):101-7. | |||||
REF 152 | TIPP[psi]: a highly potent and stable pseudopeptide delta opioid receptor antagonist with extraordinary delta selectivity. J Med Chem. 1993 Oct 15;36(21):3182-7. | |||||
REF 153 | A topochemical approach to explain morphiceptin bioactivity. J Med Chem. 1993 Mar 19;36(6):708-19. | |||||
REF 154 | Endomorphin-2 with a beta-turn backbone constraint retains the potent micro-opioid receptor agonist properties. J Med Chem. 2008 Jan 10;51(1):173-7. | |||||
REF 155 | The importance of micelle-bound states for the bioactivities of bifunctional peptide derivatives for delta/mu opioid receptor agonists and neurokin... J Med Chem. 2008 Oct 23;51(20):6334-47. | |||||
REF 156 | Synthesis and pharmacological activity of deltorphin and dermorphin-related glycopeptides. J Med Chem. 1997 Aug 29;40(18):2948-52. | |||||
REF 157 | Design of cyclic deltorphins and dermenkephalins with a disulfide bridge leads to analogues with high selectivity for delta-opioid receptors. J Med Chem. 1994 Jan 7;37(1):141-5. | |||||
REF 158 | Opioid receptor binding and antinociceptive activity of the analogues of endomorphin-2 and morphiceptin with phenylalanine mimics in the position 3... Bioorg Med Chem Lett. 2006 Jul 15;16(14):3688-92. | |||||
REF 159 | Structure-activity study of endomorphin-2 analogs with C-terminal modifications by NMR spectroscopy and molecular modeling. Bioorg Med Chem. 2008 Jun 15;16(12):6415-22. | |||||
REF 160 | Characterization of [3H]naltrindole binding to delta opioid receptors in rat brain. Life Sci. 1992;50(16):PL119-24. | |||||
REF 161 | Carba-analogues of fentanyl are opioid receptor agonists. J Med Chem. 2010 Apr 8;53(7):2875-81. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.