Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T57943
(Former ID: TTDR00440)
|
|||||
Target Name |
Caspase-3 (CASP3)
|
|||||
Synonyms |
Yama protein; SREBP cleavage activity 1; SCA-1; Protein Yama; Cysteine protease CPP32; Caspase 3; CPP32; CPP-32; CASP-3; Apopain
|
|||||
Gene Name |
CASP3
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Brain cancer [ICD-11: 2A00] | |||||
Function |
At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Involved in the cleavage of huntingtin. Triggers cell adhesion in sympathetic neurons through RET cleavage. Involved in the activation cascade of caspases responsible for apoptosis execution.
Click to Show/Hide
|
|||||
BioChemical Class |
Peptidase
|
|||||
UniProt ID | ||||||
EC Number |
EC 3.4.22.56
|
|||||
Sequence |
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
ADReCS ID | BADD_A05213 ; BADD_A05311 ; BADD_A05519 ; BADD_A05675 ; BADD_A08298 | |||||
HIT2.0 ID | T85U8U |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | PAC1 | Drug Info | Phase 1 | Anaplastic astrocytoma | [2], [3] | |
Mode of Action | [+] 3 Modes of Action | + | ||||
Activator | [+] 2 Activator drugs | + | ||||
1 | PAC1 | Drug Info | [1] | |||
2 | PETCM | Drug Info | [11] | |||
Inhibitor | [+] 16 Inhibitor drugs | + | ||||
1 | 2-(4-fluoro-benzyl)isoquinoline-1,3,4-trione | Drug Info | [4] | |||
2 | 2-(4-methoxy-benzyl)isoquinoline-1,3,4-trione | Drug Info | [4] | |||
3 | 2-allylisoquinoline-1,3,4-trione | Drug Info | [4] | |||
4 | 2-benzylisoquinoline-1,3,4-trione | Drug Info | [4] | |||
5 | 2-methylisoquinoline-1,3,4-trione | Drug Info | [4] | |||
6 | 2-phenethylisoquinoline-1,3,4-trione | Drug Info | [4] | |||
7 | 5-(azepan-1-ylsulfonyl)indoline-2,3-dione | Drug Info | [5] | |||
8 | 5-(azetidin-1-ylsulfonyl)indoline-2,3-dione | Drug Info | [5] | |||
9 | 5-(piperidin-1-ylsulfonyl)indoline-2,3-dione | Drug Info | [5] | |||
10 | 5-(pyrrolidin-1-ylsulfonyl)indoline-2,3-dione | Drug Info | [5] | |||
11 | Ac-Asp-Glu-Val-Asp-CHO | Drug Info | [6] | |||
12 | Ac-DEVD-CHO | Drug Info | [7] | |||
13 | AZ10417808 | Drug Info | [8] | |||
14 | Isoquinoline-1,3,4(2H)-trione | Drug Info | [4] | |||
15 | M826 | Drug Info | [10] | |||
16 | SJ-8002 | Drug Info | [12] | |||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | Glionitrin A | Drug Info | [9] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Small-molecule activation of procaspase-3 to caspase-3 as a personalized anticancer strategy. Nat Chem Biol. 2006 Oct;2(10):543-50. | |||||
REF 2 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 3 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 4 | Design, synthesis, and biological evaluation of isoquinoline-1,3,4-trione derivatives as potent caspase-3 inhibitors. J Med Chem. 2006 Mar 9;49(5):1613-23. | |||||
REF 5 | Design, synthesis, and discovery of novel non-peptide inhibitor of Caspase-3 using ligand based and structure based virtual screening approach. Bioorg Med Chem. 2009 Aug 15;17(16):6040-7. | |||||
REF 6 | Design and synthesis of a potent and selective peptidomimetic inhibitor of caspase-3. J Med Chem. 2004 Dec 16;47(26):6455-8. | |||||
REF 7 | Synthesis and evaluation of vinyl sulfones as caspase-3 inhibitors. A structure-activity study. Eur J Med Chem. 2010 Sep;45(9):3858-63. | |||||
REF 8 | Novel small molecule inhibitors of caspase-3 block cellular and biochemical features of apoptosis. J Pharmacol Exp Ther. 2003 Jan;304(1):433-40. | |||||
REF 9 | Glionitrin A, a new diketopiperazine disulfide, activates ATM-ATR-Chk1/2 via 53BP1 phosphorylation in DU145 cells and shows antitumor effect in xenograft model. Biol Pharm Bull. 2014;37(3):378-86. | |||||
REF 10 | Novel pyrazinone mono-amides as potent and reversible caspase-3 inhibitors. Bioorg Med Chem Lett. 2005 Feb 15;15(4):1173-80. | |||||
REF 11 | Distinctive roles of PHAP proteins and prothymosin-alpha in a death regulatory pathway. Science. 2003 Jan 10;299(5604):223-6. | |||||
REF 12 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1619). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.