Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T53242
(Former ID: TTDI01357)
|
|||||
Target Name |
Mycobacterium Mycolic acid synthase (MycB cma)
|
|||||
Synonyms |
cma; SAM-MT; S-adenosylmethionine-dependent methyltransferase; Mycolic acid methyltransferase; MA-MT; Cyclopropane-fatty-acyl-phospholipid synthase; Cyclopropane mycolic acid synthase; Cyclopropane fatty acid synthase; CMAS; CFA synthase; AdoMet-MT
Click to Show/Hide
|
|||||
Gene Name |
MycB cmaA1; MycB cmaA2; MycB pcaA
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | HIV-infected patients with tuberculosis [ICD-11: 1B10-1B14] | |||||
Function |
Catalyzes the conversion of a double bond to a cyclopropane ring at the distal position of an alpha mycolic acid via the transfer of a methylene group from S-adenosyl-L-methionine. Cyclopropanated mycolic acids are key factors participating in cell envelope permeability, host immunomodulation and persistence.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MPDELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKL
GLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLL AGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHER GLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWS AALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK Click to Show/Hide
|
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
1 | Pretomanid | Drug Info | Approved | Tuberculosis | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Inhibitor | [+] 1 Inhibitor drugs | + | ||||
1 | Pretomanid | Drug Info | [2] |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Role of long-chain acyl-CoAs in the regulation of mycolic acid biosynthesis in mycobacteria. Open Biol. 2017 Jul;7(7). pii: 170087. | |||||
REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019 |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.