Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T52188
(Former ID: TTDR00275)
|
|||||
| Target Name |
Plasmodium Acetyl-CoA carboxylase 1 (Malaria ACC1)
|
|||||
| Synonyms |
Acetyl-CoA carboxylase; ACC1; ACC-alpha
Click to Show/Hide
|
|||||
| Gene Name |
Malaria ACC1
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Parkinsonism [ICD-11: 8A00] | |||||
| Function |
Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. This protein carries three functions: biotin carboxyl carrier protein, biotin carboxylase, and carboxyltransferase.
Click to Show/Hide
|
|||||
| BioChemical Class |
Carbon-carbon ligase
|
|||||
| UniProt ID | ||||||
| Sequence |
SQGGGGKGIRKVENEYEIKKAYEQVQNELPNSPIFLMKVCNNVRHIEIQVVGDMYGNVCS
LSGRDCTTQRRFQKIFEEGPPSVVPYPIFREMEKSSIRLTKMIKYRGAGTIEYLYDQINK KYFFLELNPRL Click to Show/Hide
|
|||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 8 KEGG Pathways | + | ||||
| 1 | Fatty acid biosynthesis | |||||
| 2 | Pyruvate metabolism | |||||
| 3 | Propanoate metabolism | |||||
| 4 | Metabolic pathways | |||||
| 5 | Fatty acid metabolism | |||||
| 6 | AMPK signaling pathway | |||||
| 7 | Insulin signaling pathway | |||||
| 8 | Glucagon signaling pathway | |||||
| Pathwhiz Pathway | [+] 3 Pathwhiz Pathways | + | ||||
| 1 | Pyruvate Metabolism | |||||
| 2 | Propanoate Metabolism | |||||
| 3 | Fatty Acid Biosynthesis | |||||
| Reactome | [+] 4 Reactome Pathways | + | ||||
| 1 | ChREBP activates metabolic gene expression | |||||
| 2 | Import of palmitoyl-CoA into the mitochondrial matrix | |||||
| 3 | Activation of gene expression by SREBF (SREBP) | |||||
| 4 | Fatty Acyl-CoA Biosynthesis | |||||
| WikiPathways | [+] 9 WikiPathways | + | ||||
| 1 | Fatty Acid Biosynthesis | |||||
| 2 | Mesodermal Commitment Pathway | |||||
| 3 | Endoderm Differentiation | |||||
| 4 | Activation of Gene Expression by SREBP (SREBF) | |||||
| 5 | Corticotropin-releasing hormone | |||||
| 6 | Leptin signaling pathway | |||||
| 7 | SREBP signalling | |||||
| 8 | Fatty acid, triacylglycerol, and ketone body metabolism | |||||
| 9 | AMPK Signaling | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Reduced food intake and body weight in mice treated with fatty acid synthase inhibitors. Science. 2000 Jun 30;288(5475):2379-81. | |||||
| REF 2 | Synthesis and structure-activity relationships of N-{3-[2-(4-alkoxyphenoxy)thiazol-5-yl]-1- methylprop-2-ynyl}carboxy derivatives as selective acet... J Med Chem. 2006 Jun 29;49(13):3770-3. | |||||
| REF 3 | The apicoplast as an antimalarial drug target. Drug Resist Updat. 2001 Jun;4(3):145-51. | |||||
| REF 4 | Discovery of small molecule isozyme non-specific inhibitors of mammalian acetyl-CoA carboxylase 1 and 2. Bioorg Med Chem Lett. 2010 Apr 1;20(7):2383-8. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.