Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T50445
(Former ID: TTDR01381)
|
|||||
| Target Name |
CD40 messenger RNA (CD40 mRNA)
|
|||||
| Synonyms |
Tumor necrosis factor receptor superfamily member 5 (mRNA); TNFRSF5 (mRNA); CDw40 (mRNA); CD40L receptor (mRNA); Bp50 (mRNA); B-cell surfaceantigen CD40 (mRNA); B-cell surface antigen CD40 (mRNA)
Click to Show/Hide
|
|||||
| Gene Name |
CD40
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Graft-versus-host disease [ICD-11: 4B24] | |||||
| Function |
Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion. Receptor for TNFSF5/CD40LG.
Click to Show/Hide
|
|||||
| BioChemical Class |
mRNA target
|
|||||
| UniProt ID | ||||||
| Sequence |
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | NJA-730 | Drug Info | Phase 1 | Graft-versus-host disease | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | NJA-730 | Drug Info | [2] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 16 KEGG Pathways | + | ||||
| 1 | Cytokine-cytokine receptor interaction | |||||
| 2 | NF-kappa B signaling pathway | |||||
| 3 | Cell adhesion molecules (CAMs) | |||||
| 4 | Toll-like receptor signaling pathway | |||||
| 5 | Intestinal immune network for IgA production | |||||
| 6 | Malaria | |||||
| 7 | Toxoplasmosis | |||||
| 8 | HTLV-I infection | |||||
| 9 | Epstein-Barr virus infection | |||||
| 10 | Transcriptional misregulation in cancer | |||||
| 11 | Asthma | |||||
| 12 | Autoimmune thyroid disease | |||||
| 13 | Systemic lupus erythematosus | |||||
| 14 | Allograft rejection | |||||
| 15 | Primary immunodeficiency | |||||
| 16 | Viral myocarditis | |||||
| PID Pathway | [+] 1 PID Pathways | + | ||||
| 1 | CD40/CD40L signaling | |||||
| WikiPathways | [+] 6 WikiPathways | + | ||||
| 1 | Toll-like receptor signaling pathway | |||||
| 2 | Inflammatory Response Pathway | |||||
| 3 | NLR Proteins | |||||
| 4 | Human Complement System | |||||
| 5 | Allograft Rejection | |||||
| 6 | Regulation of toll-like receptor signaling pathway | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | US patent application no. 6,197,584, Antisense modulation of CD40 expression. | |||||
| REF 2 | Clinical pipeline report, company report or official report of NapaJen Pharma. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.