Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T49105
|
|||||
| Target Name |
Transmembrane protein PVRIG (PVRIG)
|
|||||
| Synonyms |
CD112 receptor; CD112R; Poliovirus receptor-related immunoglobulin domain-containing protein
Click to Show/Hide
|
|||||
| Gene Name |
PVRIG
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| Function |
Cell surface receptor for NECTIN2. May act as a coinhibitory receptor that suppresses T-cell receptor-mediated signals. Following interaction with NECTIN2, inhibits T-cell proliferation. Competes with CD226 for NECTIN2-binding.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MRTEAQVPALQPPEPGLEGAMGHRTLVLPWVLLTLCVTAGTPEVWVQVRMEATELSSFTI
RCGFLGSGSISLVTVSWGGPNGAGGTTLAVLHPERGIRQWAPARQARWETQSSISLILEG SGASSPCANTTFCCKFASFPEGSWEACGSLPPSSDPGLSAPPTPAPILRADLAGILGVSG VLLFGCVYLLHLLRRHKHRPAPRLQPSRTSPQAPRARAWAPSQASQAALHVPYATINTSC RPATLDTAHPHGGPSWWASLPTHAAHRPQGPAAWASTPIPARGSFVSVENGLYAQAGERP PHTGPGLTLFPDPRGPRAMEGPLGVR Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
| 1 | COM701 | Drug Info | Phase 1 | Solid tumour/cancer | [2] | |
| 2 | GSK4381562 | Drug Info | Phase 1 | Aggressive cancer | [3] | |
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
| Protein Name | Pfam ID | Percentage of Identity (%) | E value |
|---|---|---|---|
| Transmembrane protein PVRIG (PVRIG) | 100.000 (326/326) | 0.00E+00 | |
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Clinical pipeline report, company report or official report of Compugen. | |||||
| REF 2 | ClinicalTrials.gov (NCT03667716) COM701 (an Inhibitor of PVRIG) in Subjects With Advanced Solid Tumors.. U.S. National Institutes of Health. | |||||
| REF 3 | ClinicalTrials.gov (NCT05277051) A Phase 1 First-Time-in-Human, Open-Label Study of GSK4381562 Administered as Monotherapy and in Combination With Anticancer Agents in Participants With Selected Advanced Solid Tumors. U.S.National Institutes of Health. | |||||
| REF 4 | Clinical pipeline report, company report or official report of GlaxoSmithKline | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.