Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T44771
(Former ID: TTDI02306)
|
|||||
| Target Name |
TGF beta-2 messenger RNA (TGFB2 mRNA)
|
|||||
| Synonyms |
Transforming growth factor beta-2 proprotein (mRNA); TGF-beta 2 (mRNA); Polyergin (mRNA); Glioblastoma-derived T-cell suppressor factor (mRNA); G-TSF (mRNA); Cetermin (mRNA); BSC-1 cell growth inhibitor (mRNA)
Click to Show/Hide
|
|||||
| Gene Name |
TGFB2
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 5 Target-related Diseases | + | ||||
| 1 | Lung cancer [ICD-11: 2C25] | |||||
| 2 | Brain cancer [ICD-11: 2A00] | |||||
| 3 | Melanoma [ICD-11: 2C30] | |||||
| 4 | Neuroendocrine carcinoma [ICD-11: 2C34] | |||||
| 5 | Pancreatic cancer [ICD-11: 2C10] | |||||
| Function |
Transforming growth factor beta-2 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-2 (TGF-beta-2) chains, which constitute the regulatory and active subunit of TGF-beta-2, respectively.
Click to Show/Hide
|
|||||
| BioChemical Class |
mRNA target
|
|||||
| UniProt ID | ||||||
| Sequence |
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRK KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
| 1 | Belagenpumatucel-L | Drug Info | Phase 3 | Small-cell lung cancer | [2] | |
| 2 | OT-101 | Drug Info | Phase 2/3 | Melanoma | [3] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | Ranagengliotucel-T | Drug Info | Discontinued in Phase 3 | Brain cancer | [4] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | OT-101 | Drug Info | [5] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | National Cancer Institute Drug Dictionary (drug id 590662). | |||||
| REF 2 | ClinicalTrials.gov (NCT00676507) Phase III Lucanix Vaccine Therapy in Advanced Non-small Cell Lung Cancer (NSCLC) Following Front-line Chemotherapy. U.S. National Institutes of Health. | |||||
| REF 3 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017210) | |||||
| REF 5 | Clinical pipeline report, company report or official report of Oncotelic. | |||||
| REF 6 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017210) | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.