Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T43303
(Former ID: TTDR01364)
|
|||||
Target Name |
Human papillomavirus-18 E6 region messenger RNA (HPV-18 E6 mRNA)
|
|||||
Synonyms |
HPV-18 protein E6 (mRNA); HPV-18 E6 (mRNA)
Click to Show/Hide
|
|||||
Gene Name |
HPV-18 E6 mRNA
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
Acts mainly as an oncoprotein by stimulating the destruction of many host cell key regulatory proteins. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase, and inactivates tumor suppressors TP53 and TP73 by targeting them to the 26S proteasome for degradation. In turn, DNA damage and chromosomal instabilities increase and lead to cell proliferation and cancer development. The complex E6/E6AP targets several other substrates to degradation via the proteasome including host DLG1 or NFX1, a repressor of human telomerase reverse transcriptase (hTERT). The resulting increased expression of hTERT prevents the shortening of telomere length leading to cell immortalization. Other cellular targets including BAK1, Fas-associated death domain-containing protein (FADD) and procaspase 8, are degraded by E6/E6AP causing inhibition of apoptosis. E6 also inhibits immune response by interacting with host IRF3 and TYK2. These interactions prevent IRF3 transcriptional activities and inhibit TYK2-mediated JAK-STAT activation by interferon alpha resulting in inhibition of the interferon signaling pathway. Plays a major role in the induction and maintenance of cellular transformation.
Click to Show/Hide
|
|||||
BioChemical Class |
mRNA target
|
|||||
UniProt ID | ||||||
Sequence |
MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSI
PHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPLNPAEKLRH LNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV Click to Show/Hide
|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | US patent application no. 5,457,189, Antisense oligonucleotide inhibition of papillomavirus. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.