Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T40126
|
|||||
| Target Name |
Pseudomonas Kynureninase (Pseudo kynU)
|
|||||
| Synonyms |
L-kynurenine hydrolase
Click to Show/Hide
|
|||||
| Gene Name |
Pseudo kynU
|
|||||
| Target Type |
Preclinical target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Bacterial infection [ICD-11: 1A00-1C4Z] | |||||
| Function |
Catalyzes the cleavage of L-kynurenine (L-Kyn) and L-3-hydroxykynurenine (L-3OHKyn) into anthranilic acid (AA) and 3-hydroxyanthranilic acid (3-OHAA), respectively.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 3.7.1.3
|
|||||
| Sequence |
MTTRDDCLALDAGDPLADLRQLFALPDGVIYLDGNSLGARPRAAVERAAEVVAAEWGEGL
IRSWNSADWRGLPERLGDKLAPLIGARAGEVVITDTTSINLFKVLSAALRIQEEDAPGRK VIVSESSNFPTDLYIAEGLTDMLQRGYRLRLVDDPEQLPAAIDADTAVVMLSHVNYKTGY LHDMREVTRLVHENGALAIWDLAHSAGALPLDLHAADADYAIGCTYKYLNGGPGSPAYVW VAPRLRERVWQPLSGWFGHSRQFAMEPRYQPGEGITRFLCGTQPITSLALVECGLDIFAR TDMQRLRDKSLALADLFIELVESRCERFGLTLVTPREHARRGSHVSFEHAQGYAIVQALI DRGVIGDYREPGILRFGFTPLYTRFVEVWDAVQALLEILQSEAWKEPRYQVRHKVT Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
| 1 | S-Phenyl-L-cysteine sulfoxide | Drug Info | Preclinical | Bacterial infection | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | S-Phenyl-L-cysteine sulfoxide | Drug Info | [1] | |||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Chemical Inhibition of Kynureninase Reduces Pseudomonas aeruginosa Quorum Sensing and Virulence Factor Expression. ACS Chem Biol. 2016 Apr 15;11(4):1106-17. | |||||
| REF 2 | Tryptophan metabolism as a common therapeutic target in cancer, neurodegeneration and beyond. Nat Rev Drug Discov. 2019 May;18(5):379-401. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.