Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T38012
(Former ID: TTDI02593)
|
|||||
Target Name |
Inward rectifier potassium channel Kir3.1 (KCNJ3)
|
|||||
Synonyms |
Potassium channel, inwardly rectifying subfamily J member 3; KCNJ3; Inward rectifier K(+) channel Kir3.1; GIRK1; G proteinactivated inward rectifier potassium channel 1
|
|||||
Gene Name |
KCNJ3
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
This potassium channel is controlled byG proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This receptor plays a crucial role in regulating the heartbeat.
Click to Show/Hide
|
|||||
BioChemical Class |
Inward rectifier potassium channel
|
|||||
UniProt ID | ||||||
Sequence |
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEIVVILE GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMS STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG AARMEGNLPAKLRKMNSDRFT Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A03957 ; BADD_A04007 ; BADD_A05962 |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 9 KEGG Pathways | + | ||||
1 | Circadian entrainment | |||||
2 | Retrograde endocannabinoid signaling | |||||
3 | Glutamatergic synapse | |||||
4 | Cholinergic synapse | |||||
5 | Serotonergic synapse | |||||
6 | Dopaminergic synapse | |||||
7 | Estrogen signaling pathway | |||||
8 | Oxytocin signaling pathway | |||||
9 | Morphine addiction | |||||
Panther Pathway | [+] 3 Panther Pathways | + | ||||
1 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
2 | Muscarinic acetylcholine receptor 2 and 4 signaling pathway | |||||
3 | GABA-B receptor II signaling | |||||
Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
1 | Muscle/Heart Contraction | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Activation of G protein gated Potassium channels | |||||
2 | Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits | |||||
WikiPathways | [+] 4 WikiPathways | + | ||||
1 | Calcium Regulation in the Cardiac Cell | |||||
2 | G Protein Signaling Pathways | |||||
3 | Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | |||||
4 | Potassium Channels |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Direct activation of inward rectifier potassium channels by PIP2 and its stabilization by Gbetagamma. Nature. 1998 Feb 19;391(6669):803-6. | |||||
REF 2 | ML297 (VU0456810), the first potent and selective activator of the GIRK potassium channel, displays antiepileptic properties in mice. ACS Chem Neurosci. 2013 Sep 18;4(9):1278-86. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.