Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T37298
(Former ID: TTDI02265)
|
|||||
| Target Name |
MYCBP messenger RNA (MYCBP mRNA)
|
|||||
| Synonyms |
c-Myc-binding protein (mRNA); Associate of Myc 1 (mRNA); AMY1 (mRNA); AMY-1 (mRNA)
Click to Show/Hide
|
|||||
| Gene Name |
MYCBP
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Liver cancer [ICD-11: 2C12] | |||||
| Function |
Stimulates the activation of E box-dependent transcription by MYC. May control the transcriptional activity of MYC.
Click to Show/Hide
|
|||||
| BioChemical Class |
mRNA target
|
|||||
| UniProt ID | ||||||
| Sequence |
MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENP
EIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | DCR-MYC | Drug Info | Phase 1/2 | Hepatocellular carcinoma | [2] | |
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| Panther Pathway | [+] 1 Panther Pathways | + | ||||
| 1 | PDGF signaling pathway | |||||
| PID Pathway | [+] 1 PID Pathways | + | ||||
| 1 | Notch signaling pathway | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | National Cancer Institute Drug Dictionary (drug id 759983). | |||||
| REF 2 | ClinicalTrials.gov (NCT02314052) Phase Ib/2, Multicenter, Dose Escalation Study of DCR-MYC in Patients With Hepatocellular Carcinoma. U.S. National Institutes of Health. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.