Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T37245
(Former ID: TTDC00241)
|
|||||
Target Name |
RTP801 messenger RNA (RTP801 mRNA)
|
|||||
Synonyms |
RTP801 (mRNA); REDD1 (mRNA); REDD-1 (mRNA); Protein regulated in development and DNA damage response 1 (mRNA); HIF-1 responsive protein RTP801 (mRNA); DNA damage-inducible transcript 4 protein (mRNA)
Click to Show/Hide
|
|||||
Gene Name |
DDIT4
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Macular degeneration [ICD-11: 9B75] | |||||
2 | Retinopathy [ICD-11: 9B71] | |||||
Function |
Inhibition of mTORC1 is mediated by a pathway that involves DDIT4/REDD1, AKT1, the TSC1-TSC2 complex and the GTPase RHEB. Plays an important role in responses to cellular energy levels and cellular stress, including responses to hypoxia and DNA damage. Regulates p53/TP53-mediated apoptosis in response to DNA damage via its effect on mTORC1 activity. Its role in the response to hypoxia depends on the cell type; it mediates mTORC1 inhibition in fibroblasts and thymocytes, but not in hepatocytes. Required for mTORC1-mediated defense against viral protein synthesis and virus replication. Inhibits neuronal differentiation and neurite outgrowth mediated by NGF via its effect on mTORC1 activity. Required for normal neuron migration during embryonic brain development. Plays a role in neuronal cell death. Regulates cell growth, proliferation and survival via inhibition of the activity of the mammalian target of rapamycin complex 1 (mTORC1).
Click to Show/Hide
|
|||||
BioChemical Class |
mRNA target
|
|||||
UniProt ID | ||||||
Sequence |
MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSS
NSGFGPEEDTAYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMP SQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALDPSLVPTFQLTLVLR LDSRLWPKIQGLFSSANSPFLPGFSQSLTLSTGFRVIKKKLYSSEQLLIEEC Click to Show/Hide
|
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | PF-4523655 | Drug Info | Phase 2 | Age-related macular degeneration | [2] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
1 | mTOR signaling pathway | |||||
2 | PI3K-Akt signaling pathway | |||||
3 | MicroRNAs in cancer | |||||
NetPath Pathway | [+] 2 NetPath Pathways | + | ||||
1 | IL4 Signaling Pathway | |||||
2 | TGF_beta_Receptor Signaling Pathway | |||||
PID Pathway | [+] 2 PID Pathways | + | ||||
1 | mTOR signaling pathway | |||||
2 | Direct p53 effectors | |||||
Reactome | [+] 1 Reactome Pathways | + | ||||
1 | TP53 Regulates Metabolic Genes | |||||
WikiPathways | [+] 1 WikiPathways | + | ||||
1 | TOR Signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | DNA-damage-inducible transcript 4 (DDIT4; RTP801). SciBX 3(20); doi:10.1038/scibx.2010.629. May 20 2010 | |||||
REF 2 | 2011 Pipeline of Quark Pharm. | |||||
REF 3 | Pfizer. Product Development Pipeline. March 31 2009. | |||||
REF 4 | The effects of the oral, pan-VEGF-R kinase inhibitor CEP-7055 and chemotherapy in orthotopic models of glioblastoma and colon carcinoma in mice. Mol Cancer Ther. 2006 Jul;5(7):1744-53. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.