Target Information

Target General Information

Top

Target ID

T35474 (Former ID: TTDI02684)

Target Name

KRAS messenger RNA (KRAS mRNA)

Synonyms

c-Ki-ras (mRNA); c-K-ras (mRNA); RASK2 (mRNA); Ki-Ras (mRNA); KRAS2 (mRNA); K-Ras 2 (mRNA); GTPase KRas (mRNA)

Click to Show/Hide

Gene Name

KRAS

Target Type

Literature-reported target

[1]

Disease

[+] 1 Target-related Diseases

Solid tumour/cancer [ICD-11: 2A00-2F9Z]

Function

Plays an important role in the regulation of cell proliferation. Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.

Click to Show/Hide

BioChemical Class

mRNA target

UniProt ID

RASK_HUMAN

Sequence

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM

Click to Show/Hide

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Target Affiliated Biological Pathways		Top
KEGG Pathway	[+] 55 KEGG Pathways	+
1	MAPK signaling pathway
2	ErbB signaling pathway
3	Ras signaling pathway
4	Rap1 signaling pathway
5	Chemokine signaling pathway
6	FoxO signaling pathway
7	Sphingolipid signaling pathway
8	PI3K-Akt signaling pathway
9	Dorso-ventral axis formation
10	Axon guidance
11	VEGF signaling pathway
12	Tight junction
13	Gap junction
14	Signaling pathways regulating pluripotency of stem cells
15	Natural killer cell mediated cytotoxicity
16	T cell receptor signaling pathway
17	B cell receptor signaling pathway
18	Fc epsilon RI signaling pathway
19	Long-term potentiation
20	Neurotrophin signaling pathway
21	Cholinergic synapse
22	Serotonergic synapse
23	Long-term depression
24	Regulation of actin cytoskeleton
25	Insulin signaling pathway
26	GnRH signaling pathway
27	Progesterone-mediated oocyte maturation
28	Estrogen signaling pathway
29	Melanogenesis
30	Prolactin signaling pathway
31	Thyroid hormone signaling pathway
32	Oxytocin signaling pathway
33	Aldosterone-regulated sodium reabsorption
34	Alcoholism
35	Hepatitis C
36	Hepatitis B
37	HTLV-I infection
38	Pathways in cancer
39	Viral carcinogenesis
40	Proteoglycans in cancer
41	MicroRNAs in cancer
42	Colorectal cancer
43	Renal cell carcinoma
44	Pancreatic cancer
45	Endometrial cancer
46	Glioma
47	Prostate cancer
48	Thyroid cancer
49	Melanoma
50	Bladder cancer
51	Chronic myeloid leukemia
52	Acute myeloid leukemia
53	Non-small cell lung cancer
54	Central carbon metabolism in cancer
55	Choline metabolism in cancer
NetPath Pathway	[+] 1 NetPath Pathways	+
1	TCR Signaling Pathway
Panther Pathway	[+] 3 Panther Pathways	+
1	Inflammation mediated by chemokine and cytokine signaling pathway
2	Ras Pathway
3	p53 pathway feedback loops 2
Pathwhiz Pathway	[+] 1 Pathwhiz Pathways	+
1	Fc Epsilon Receptor I Signaling in Mast Cells
PID Pathway	[+] 1 PID Pathways	+
1	Regulation of Ras family activation
Reactome	[+] 32 Reactome Pathways	+
1	SOS-mediated signalling
2	Activation of RAS in B cells
3	Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants
4	SHC1 events in ERBB2 signaling
5	SHC1 events in ERBB4 signaling
6	p38MAPK events
7	GRB2 events in EGFR signaling
8	SHC1 events in EGFR signaling
9	GRB2 events in ERBB2 signaling
10	Tie2 Signaling
11	EGFR Transactivation by Gastrin
12	DAP12 signaling
13	SHC-related events triggered by IGF1R
14	FCERI mediated MAPK activation
15	NCAM signaling for neurite out-growth
16	VEGFR2 mediated cell proliferation
17	CD209 (DC-SIGN) signaling
18	Constitutive Signaling by EGFRvIII
19	SHC-mediated cascade:FGFR1
20	FRS-mediated FGFR1 signaling
21	SHC-mediated cascade:FGFR2
22	FRS-mediated FGFR2 signaling
23	SHC-mediated cascade:FGFR3
24	FRS-mediated FGFR3 signaling
25	FRS-mediated FGFR4 signaling
26	SHC-mediated cascade:FGFR4
27	Regulation of RAS by GAPs
28	RAF activation
29	RAF/MAP kinase cascade
30	MAP2K and MAPK activation
31	Negative regulation of MAPK pathway
32	Insulin receptor signalling cascade
WikiPathways	[+] 37 WikiPathways	+
1	Serotonin Receptor 2 and ELK-SRF/GATA4 signaling
2	DNA Damage Response (only ATM dependent)
3	ErbB Signaling Pathway
4	Regulation of Actin Cytoskeleton
5	EGF/EGFR Signaling Pathway
6	MAPK Cascade
7	MAPK Signaling Pathway
8	G Protein Signaling Pathways
9	Extracellular vesicle-mediated signaling in recipient cells
10	Signaling by ERBB4
11	Signaling by ERBB2
12	Fc epsilon receptor (FCERI) signaling
13	Signaling by the B Cell Receptor (BCR)
14	RAF/MAP kinase cascade
15	Signaling by SCF-KIT
16	DAP12 interactions
17	Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R)
18	Gastrin-CREB signalling pathway via PKC and MAPK
19	Nanoparticle-mediated activation of receptor signaling
20	Aryl Hydrocarbon Receptor
21	Integrated Pancreatic Cancer Pathway
22	Oncostatin M Signaling Pathway
23	TNF alpha Signaling Pathway
24	RalA downstream regulated genes
25	Signaling Pathways in Glioblastoma
26	miR-targeted genes in muscle cell - TarBase
27	miR-targeted genes in lymphocytes - TarBase
28	miR-targeted genes in epithelium - TarBase
29	Integrated Breast Cancer Pathway
30	Signaling by PDGF
31	Signaling by Insulin receptor
32	Signaling by FGFR
33	Signaling by EGFR
34	NGF signalling via TRKA from the plasma membrane
35	NCAM signaling for neurite out-growth
36	Cell surface interactions at the vascular wall
37	IL-5 Signaling Pathway

References

Top

REF 1

URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2824).

REF 2

Antisense oligonucleotides demonstrate a dominant role of c-Ki-RAS proteins in regulating the proliferation of diploid human fibroblasts. J Biol Chem. 1996 Nov 8;271(45):28259-65.

REF 3

US patent application no. 5,965,722, Antisense inhibition of ras gene with chimeric and alternating oligonucleotides.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN