Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T34563
(Former ID: TTDR00089)
|
|||||
Target Name |
Staphylococcus D-amino acid aminotransferase (Stap-coc dat)
|
|||||
Synonyms |
Stap-coc dat; DAAT; D-aspartate aminotransferase; D-amino acid transaminase; D-alanine aminotransferase
Click to Show/Hide
|
|||||
Gene Name |
Stap-coc dat
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
Acts on the D-isomers of alanine, leucine, aspartate, glutamate, aminobutyrate, norvaline and asparagine. The enzyme transfers an amino group from a substrate D-amino acid to the pyridoxal phosphate cofactor to form pyridoxamine andan alpha- keto acid in the first half-reaction. The second half-reaction is the reverse of the first, transferring the amino group from the pyridoxamine to a second alpha-keto acid to form the product D- amino acid via a ping-pong mechanism. This is an important process in the formation of D-alanine and D-glutamate, which are essential bacterial cell wall components.
Click to Show/Hide
|
|||||
BioChemical Class |
Transaminase
|
|||||
UniProt ID | ||||||
EC Number |
EC 2.6.1.21
|
|||||
Sequence |
MTKVFINGEFIDQNEAKVSYEDRGYVFGDGIYEYIRAYDGKLFTVTEHFERFIRSASEIQ
LDLGYTVEELIDVVRELLKVNNIQNGGIYIQATRGVAPRNHSFPTPEVKPVIMAFAKSYD RPYDDLENGINAATVEDIRWLRCDIKSLNLLGNVLAKEYAVKYNAGEAIQHRGETVTEGA SSNVYAIKDGAIYTHPVNNYILNGITRKVIKWISEDEDIPFKEETFTVEFLKNADEVIVS STSAEVTPVVKIDGEQVGDGKVGPVTRQLQEGFNKYIESRSS Click to Show/Hide
|
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.